CAZyme Information: HCAG_09319-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_09319-t26_1-p1
• CAZy Family: GT69
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
125		14528.44	7.4009

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=DS264859:156-606(+)

Full Sequence      

MVALSGAHSLGRAHPDRSGYDGPWDFSPTVFTNEFFRLLVEEKWNWKKWSGPAQYTDNTT
KTLMMLPTDMALVKDKEFKKHVERYAKDSDAFFREFSDAFVKLLELGVPFTSKAEDRIRF
KSSHD

Enzyme Prediction     

No EC number prediction in HCAG_09319-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	1	108	8.6e-23	0.4235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	4.48e-53	2	110	156	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	5.47e-31	1	114	153	250	L-ascorbate peroxidase
178467	PLN02879	1.10e-22	1	107	156	246	L-ascorbate peroxidase
166005	PLN02364	3.68e-22	1	107	156	246	L-ascorbate peroxidase 1
173823	plant_peroxidase_like	1.38e-21	1	105	151	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS64247.1|AA2	2.34e-91	1	125	23	147
QSS52101.1|AA2	3.86e-88	1	125	250	374
QSS70081.1|AA2	1.55e-87	1	125	250	374
QGA20343.1|AA2	5.44e-72	1	123	239	359
QKX53632.1|AA2	7.27e-72	1	123	237	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V2E_A	4.11e-30	1	122	168	288	Structure of isoniazid (INH) bound to cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae]
2V23_A	4.27e-30	1	122	170	290	Structure of cytochrome c peroxidase mutant N184R Y36A [Saccharomyces cerevisiae],4A6Z_A Cytochrome c peroxidase with bound guaiacol [Saccharomyces cerevisiae]
3M23_A	5.45e-30	1	122	165	285	Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M25_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M26_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M27_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M28_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M29_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2A_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2B_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2C_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2D_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2E_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2F_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2G_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2H_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae],3M2I_A Chain A, Cytochrome c peroxidase, mitochondrial [Saccharomyces cerevisiae]
5EJT_A	5.77e-30	1	122	168	288	Thermally annealed ferryl Cytochrome C Peroxidase crystal structure [Saccharomyces cerevisiae S288C],5EJX_A X-ray Free Electron Laser Structure of Cytochrome C Peroxidase [Saccharomyces cerevisiae S288C]
4A71_A	5.99e-30	1	122	170	290	cytochrome c peroxidase in complex with phenol [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	1.01e-73	1	123	243	365	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|P0C0V3|CCPR_EMENI	1.18e-68	1	123	238	360	Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ccp1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	1.04e-57	1	124	232	356	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	8.29e-54	1	115	235	349	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	1.45e-50	1	109	261	369	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.969243	0.030797

TMHMM  Annotations     

There is no transmembrane helices in HCAG_09319-t26_1-p1.