CAZyme Information: HCAG_08670-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_08670-t26_1-p1
• CAZy Family: GT57
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	CH476666|CGC1	56522.07	6.2374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476666:332975-335235(+)

Full Sequence      

MTDTYDFIIVGGGNSGLLFATRLATALPESSVVVLESGSAFPDNSHLCQYDRYHAWQRPD
LDLGYITTPQTSLKGRVLPYLRGKGPGGCTNVNFLTYTRGSAEDYNYWAELVGDDSWKWE
HTLRRFKELPLNMDTNSGNPIGLSIPPTTTFKGYRWTSEAIYTNYRPANLKMLTDIKVAK
VVFENKVAVGIQAVDGRNFTANKEVILSAGVFDSAKILLLSGIGPTQELSQHNIQTIHDL
PGVGKGLSDHPLVVIGASFAPGVGLSDRTQFDSNPAALEAAREQWKRDGTGEINLHRSCV
ITGWLKENSILTTSEYQNLDTLSKQYLTKDSVPHYELFLAGPHFPPTYVVPEGTSYLSTV
VCLMNMQSRGEITLKSANVNDPPAIDSNYMSHPFDRKMLTLAIREAMKFYQSGAIEKEFK
GYVLAPKSQSDEDIHEFIDENLLPVFHANGTLKMGKADDPMACTDPSFRIYGVEKLRVVD
LSVCPITPNQPTAYLVAQTAAGKIIAEYGGRR

Enzyme Prediction     

No EC number prediction in HCAG_08670-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	129	506	8.9e-89	0.6848591549295775

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.20e-80	1	504	2	531	choline dehydrogenase; Validated
225186	BetA	1.09e-70	1	512	4	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
215420	PLN02785	1.41e-34	4	511	55	583	Protein HOTHEAD
366272	GMC_oxred_N	2.61e-22	71	251	12	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
183292	PRK11728	6.90e-04	4	36	2	34	L-2-hydroxyglutarate oxidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS73506.1|AA3_2	0.0	1	512	1	567
QSS48722.1|AA3_2	0.0	1	512	1	567
QRC97674.1|AA3_2	3.06e-121	1	509	1	564
QSZ30159.1|AA3_2	9.27e-117	3	508	7	585
CAE7200393.1|AA3_2	1.38e-116	3	508	4	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.19e-49	5	507	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.01e-48	5	507	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4H7U_A	8.84e-44	5	508	41	601	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	1.93e-42	5	510	14	532	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	1.93e-42	5	510	14	532	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B8A1|PKFF_EMENI	3.60e-63	4	504	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A075TRK9|PATE_PENEN	2.57e-58	3	504	50	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	3.46e-56	3	501	49	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.44e-53	5	505	2	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	8.46e-53	6	489	4	507	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in HCAG_08670-t26_1-p1.