CAZyme Information: HCAG_08156-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_08156-t26_1-p1
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543	CH476664|CGC3	60078.49	5.8652

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476664:868634-870440(+)

Full Sequence      

MATTDHLSAADVDSYDYVIVGGGTAGCVIASRLAEYLPRMRILVIEAGPSDYKNDRILIL
KDWLSLLGSQEFDYDYGTVEQPMGNSSIRHSRAKVLGGCSSHNTLISFRIFEYDCKLWES
MGCKGWDFETFTRLADNLRNTIQPVHLRHRNQLCKDWVESCSSALNIPVIEDFNKEIREN
GKLTECVGFFSIAYNPEDGRRSSASVAYIHPVLCGDEKRPNLTILTNAWVSRVNVKDDTV
TGINLTLKCGEKLTVNAKRETILCAGSVDTPRLLLLSGIGPQEQLSSLSIPVVKDIPGVG
ENLLDHPESIIIWELNKPVPPNQTTMDSDAGVFLRREAPNAAGFDGDAADVMMHCYQIPF
CVNTSRLGYDVPMNAFCMTPNIPRPRSRGRLYLTSADPAVKPALDFRYFTDPEGYDAATI
VAGFKAARKVAQQAPFKDWIKREVAPGPDLTTDEELSEYGRRAAHTVYHPAGTTKMGDVV
NDPYAVVDSQLKVKGLRRLRIADAGVFPTMPTVNPMVTVLAIAERAAELIAEEVGWRKET
ARL

Enzyme Prediction     

No EC number prediction in HCAG_08156-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	10	540	4.2e-92	0.5210355987055016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	5.31e-118	14	533	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	5.71e-116	14	530	5	531	choline dehydrogenase; Validated
274888	Rv0697	6.25e-65	16	531	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	5.66e-45	385	526	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.79e-35	14	520	55	566	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62690.1|AA3_2	0.0	1	543	1	543
QSS74230.1|AA3_2	0.0	1	543	1	543
QSS50497.1|AA3_2	0.0	1	543	1	543
BCS03844.1|AA3_2	0.0	1	543	90	631
EAA64559.1|AA3_2	0.0	1	543	1	542

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	5.07e-115	5	530	4	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	7.16e-115	5	530	4	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	2.01e-114	5	530	4	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	5.10e-55	4	530	73	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	5.49e-55	15	530	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	2.61e-114	5	530	4	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	1.03e-77	13	531	5	534	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	1.59e-73	15	534	2	531	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q00593|ALKJ_PSEOL	3.06e-69	15	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q4A0Q1|BETA_STAS1	4.47e-69	14	530	4	533	Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000005

TMHMM  Annotations     

There is no transmembrane helices in HCAG_08156-t26_1-p1.