CAZyme Information: HCAG_07404-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_07404-t26_1-p1
• CAZy Family: GT22
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219		23753.70	9.7388

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476662:1543727-1544630(+)

Full Sequence      

MSNNRHEGHKGFPIGAVGNTGKLDYVERPNIVLLLAGTNDVVFKINLKIAPEVLGRVVDD
IVSACPDAVVLVATLPPLLDRNREARRVAFNAALPAVMEQRTEVGKHVLLVDLATVTTRH
INATDGIHPIDEGYRLIADAWYKSIVHTDQKGWIKAPIAKPANGEVDRVKPTIEARPIIA
GRPIVAGTSAGFWSPFRMLAALVVVSVGCFGAFRVYLKI

Enzyme Prediction     

No EC number prediction in HCAG_07404-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	3	145	5.8e-31	0.7422680412371134

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.26e-39	3	145	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.91e-13	15	136	40	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	9.94e-12	27	143	64	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	1.52e-07	28	140	67	181	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
238872	SGNH_hydrolase_like_2	1.46e-06	29	144	62	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS51733.1|CE3	1.19e-129	1	215	99	325
APA11680.1|CE3	6.15e-32	1	159	102	259
QIW95188.1|CE3	3.73e-30	1	161	88	248
QKX63118.1|CE3	7.10e-30	7	158	90	241
QKX54758.1|CE3	9.48e-30	6	158	79	231

PDB Hits     

HCAG_07404-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

HCAG_07404-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

Start	End
198	217