CAZyme Information: HCAG_06513-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_06513-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		60077.02	5.3507

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476660:604266-606119(+)

Full Sequence      

MRALPWTAAVLAALVSNGALAGSSHMDDPASLAIACPDYSEYSKLKHPPYSEGPLQLPFQ
RPVLPCRTFTSTSIEKVIEDVTSRMVDKDLAQLFRNAYPNTADTTVRWHVDSSDPRSKIL
TQYPQSESWQGPQSFIVTGDINAEWLRDSANQVAGYQMLAAKDPKIKALILGAINTQVEF
VLQSPYCNAFQPPPPSGLLHSISQTQSDIVHPAYEQSVVFECKYELDSLANFLAIGNKFF
AETKSTEFVTTRWYRAVLTVLEVIEEQSKPTFDVQGEYVRNTYTFKRLTTLGTETLNLDG
VGNPLNNGTGLVRSAFRPSDDATIFGYFIPANAYLSVELKRTALTIKAAGGPDSLIQTLE
QRASIIEKGIRDHGIVSHKKFGEIYAFEVDGYGSRLLMDDANLPSLLSLPLLGFVDKDDE
VYQNTRKMLLNKTGNPYYLTGTQFHGIGGPHAGLSNAWPMSVLVRARTSDDDEEIMESIN
MVRNASLLGLIHESVDVDNIRVYTRSWFAWANSVFAQTILELAERKPYLLFGKGASPYKA
GE

Enzyme Prediction     

No EC number prediction in HCAG_06513-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	87	520	8.4e-159	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	87	520	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.37e-147	66	530	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS59948.1|GH125	0.0	1	542	1	542
QSS68485.1|GH125	0.0	1	542	1	542
QSS49978.1|GH125	0.0	1	542	1	542
QVM13217.1|GH125	2.35e-263	27	542	29	547
CAK38960.1|GH125	1.79e-259	1	538	1	533

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	6.65e-92	61	522	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	1.41e-89	61	522	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	7.01e-87	61	522	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	1.86e-77	74	521	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
3QT3_A	2.10e-77	74	521	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	2.30e-180	35	530	26	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999743	CS pos: 21-22. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in HCAG_06513-t26_1-p1.