CAZyme Information: HCAG_06236-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_06236-t26_1-p1
• CAZy Family: GT17
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46843.09	5.7217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476661:2054141-2055813(+)

Full Sequence      

MAPAFDFIVVGTLLLEAGDNLEDRNLRVDGQRWLTFQNKNMNWGYQTVPQEYCNNSELDY
SRGRGVGGSSAINFGVYSLGARDDYDKWAKIVGDDAFNWDHIHARFKELETFHGEVPAGV
DKKYAVPKAADHGTTGPLHVGNAAEWEKDLVPTLDIFEQAGFPLNPDHNSGNPIGMSVLI
NSAHKGLRSTAKDLLQRQAQNLTIMANSPVQRLLIEDKKAVGVVANGTRCWFKIDGLTQT
KEFEDLPSEEQEYLQEVTVPHFEIFTHFPIHWPVARLHCNLRIQTSLCAWIQNSSPTPLI
VVLQLISLRDAFRIAKHPAYIKDKLAELAAPKSNSDEDLLEYWKQNISSSWHIICTAKMG
KARDADAVVDCDYRVMGIDGLRVADMRVIPVLVSGHIQAAEYVTGDACAEKLIKEYNLA

Enzyme Prediction     

No EC number prediction in HCAG_06236-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	225	8.9e-49	0.38380281690140844

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.30e-42	1	415	4	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	4.23e-34	1	399	2	518	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.17e-21	308	412	38	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.77e-13	53	225	14	167	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	0.006	331	385	500	549	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS64539.1|AA3_2	5.53e-301	1	419	1	452
QSS70419.1|AA3_2	1.55e-244	1	419	1	564
QMW45359.1|AA3_2	5.19e-175	1	419	1	564
QMW33321.1|AA3_2	5.19e-175	1	419	1	564
UDD61192.1|AA3_2	5.19e-175	1	419	1	564

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.00e-19	13	244	68	298	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	4.09e-18	10	214	26	234	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.10e-18	10	214	27	235	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3LJP_A	2.26e-16	10	410	38	524	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	5.36e-16	10	410	38	524	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1QXE1|BETA1_CHRSD	5.14e-23	10	412	31	535	Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA1 PE=3 SV=1
sp|Q1MJU4|BETA_RHIL3	3.13e-21	39	419	56	532	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=betA PE=3 SV=1
sp|C3MIE4|BETA_SINFN	3.13e-21	42	419	59	532	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	1.93e-20	1	413	1	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|B5ZUG2|BETA_RHILW	2.46e-20	39	419	56	532	Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) OX=395492 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.802868	0.197146

TMHMM  Annotations     

There is no transmembrane helices in HCAG_06236-t26_1-p1.