CAZyme Information: HCAG_05929-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_05929-t26_1-p1
• CAZy Family: GH93
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		39400.55	4.9122

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476661:972691-974451(-)

Full Sequence      

MKLSSGSMAGLAMSLLSGSKLVAAQTWTSCNPMEKTCPPDPALGGTADFEFHSVSERFDV
LGGAPTYGSNGASLAVAKQGDAPTLVSKFYIMFGHVDFVIKAAPGRGIVSSAVLQSDDLD
EIDWEWLGVDNAQVQTNYFGKNQQGTFDRGQFHANPGNQDGFHTYSIDWNSDRLIWQIDG
QTVRTLTAASAGASYPQTPMQIKAGVWAGGDPFQSSWNYRGSWQSIEAIGGKVNGHGTPG
SGPQVESSIPPAEATRPPTTKGIIHPSEYPWVPSSTLKPESTPSITSFAGLPSEWIVTDS
GRATPPSTASSASQSASRSSPSSPVSVSSSAGGPESPSATGTSSPNATVAPGTGAANLNF
PISYGVSAICGLIAAVAFFQ

Enzyme Prediction     

No EC number prediction in HCAG_05929-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	70	214	6e-64	0.9240506329113924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	1.41e-86	48	212	2	169	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	2.29e-51	62	212	3	155	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	2.34e-21	88	212	62	189	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.79e-20	93	217	68	191	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	9.21e-14	85	226	40	184	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67372.1|GH16_18	6.35e-228	1	380	1	415
QSS57604.1|GH16_18	1.49e-226	1	380	1	415
QSS66185.1|GH16_18	1.67e-153	1	212	1	212
BCR92735.1|GH16_18	7.69e-94	10	310	7	349
EAA59223.1|GH16_18	9.15e-94	10	310	7	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	7.23e-68	27	212	1	191	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
5SV8_A	4.69e-13	120	207	88	171	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
5DZE_A	2.91e-12	120	207	87	170	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with cellotetraose [Vitis vinifera]
5DZF_A	2.96e-12	120	207	88	171	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera],5DZF_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a mixed-linkage glucan octasaccharide [Vitis vinifera]
5DZG_A	3.01e-12	120	207	89	172	Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera],5DZG_B Crystal Structure of the catalytic nucleophile mutant of VvEG16 in complex with a xyloglucan tetradecasaccharide [Vitis vinifera]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALQ5|CRH11_ARTBC	2.47e-89	11	313	5	355	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	6.22e-68	21	212	16	212	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P53301|CRH1_YEAST	2.05e-54	29	235	39	284	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	6.66e-49	22	239	23	238	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2
sp|Q5AFA2|CRH11_CANAL	1.70e-48	29	235	23	269	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.192924	0.807063	CS pos: 24-25. Pr: 0.7027

TMHMM  Annotations     

Start	End
360	379