CAZyme Information: HCAG_05022-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_05022-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
247		26587.86	11.0093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476659:548293-549727(+)

Full Sequence      

MHLSILIAAALSVVSSVLASSILEARQCIGPHVNKATLALIKEFEGFVPRPEPDPIGLPT
VGYGHLCKTKGCKEVKFPLSKGTATTLLKKDLRSFQQAITLSTKTAVKLNANQYGALVSW
AYNVGPNAARSSSLISRLNQGEDPNQVIAQELPKWRLAGGKVFEGLVRRRKAEVKLAKTP
TKSKALPQQHAVSCKVAASVSSGYRFRGLDGAHLDRVHMIHVAQTSRAKQFSNTGGAKTF
QPRGRGV

Enzyme Prediction     

No EC number prediction in HCAG_05022-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	33	173	1.2e-37	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381599	lyz_endolysin_autolysin	1.24e-50	38	176	2	134	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381620	lyz_P1	1.14e-30	33	173	2	135	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
381619	endolysin_R21-like	2.51e-30	36	173	7	137	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
226295	RrrD	4.14e-29	38	180	12	150	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
395766	Phage_lysozyme	7.21e-14	59	171	2	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63085.1|GH24	7.24e-125	1	190	1	190
UNI14262.1|GH24	5.05e-55	25	187	20	184
UPL03217.1|GH24	4.78e-53	28	187	24	185
BCS23042.1|GH24	8.50e-51	28	187	23	184
QKD50435.1|GH24	1.81e-50	28	187	95	256

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.04e-15	40	173	59	189	Chain A, Lysozyme [Acinetobacter baumannii]
3HDF_A	5.62e-10	45	173	10	131	Chain A, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	8.92e-10	45	173	35	156	Chain A, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
4ZPU_A	1.44e-09	45	173	35	156	The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_B The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_C The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_D The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12]
6H9D_A	1.75e-09	33	180	6	149	Chain A, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11187|ENLYS_BPPH2	4.30e-17	33	181	3	146	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
sp|P07540|ENLYS_BPPZA	8.24e-17	33	181	3	146	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1
sp|Q37896|ENLYS_BPB03	1.04e-13	32	173	2	138	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
sp|O80292|ENLYS_BPPS1	1.82e-09	45	173	37	158	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
sp|P78285|LYSD_ECOLI	6.31e-09	45	173	35	156	Lysozyme RrrD OS=Escherichia coli (strain K12) OX=83333 GN=rrrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000412	0.999575	CS pos: 26-27. Pr: 0.5442

TMHMM  Annotations     

There is no transmembrane helices in HCAG_05022-t26_1-p1.