CAZyme Information: HCAG_01268-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_01268-t26_1-p1
• CAZy Family: AA7
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	CH476655|CGC3	55553.96	7.7798

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476655:4459202-4461019(+)

Full Sequence      

MADAFTELGVAHLREHAMGNAVGQFWAPATIDAKTMTRSSSLTAYYDKASWRPNLKMLTE
HKVTQLTFKGASTTVSGVKAINRKTNKEVTFHARKEVILAAGSLHTPQILQLSGIGPKCV
VQAAGIKSRVDLPGVGSNLQDHPVAYLNWKVTNSFPEPNIMMTNETFAAEALAEYQAHRT
GPYTKAQSNTIAFLSLPMVTNNTEDMINSLKQQVASKYLPGVYSRELISGYEAQRAILAK
QLGEGSVSALEFPFGGSGMVPNSVQKPLSRGTVHLNPDDPHGEPIVTYNAFTNPFDRAQL
ASFIAFTRRYFKTNALADMQPQEVSPGEDAQTEDEIIAKLAAGGPLSLSPSFAHPSSSCP
MMPKNKGGCVSADLRVHGTRKLSIIDASILPIIPSAHLQATIGEVFGRDGDDGPPLAHQD
VEVFCDTPVTSYLWGRSRYAAQIPNIIYPENCDARAREKNGEPDPRSPPTSCKTHSWLLT
LRSLSLRGRLYGLNTNELWSKTEQIGFSAEG

Enzyme Prediction     

No EC number prediction in HCAG_01268-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	402	2.8e-105	0.676056338028169

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.33e-44	38	424	199	545	choline dehydrogenase; Validated
225186	BetA	3.96e-40	38	402	201	522	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.76e-31	267	402	1	136	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.30e-16	38	144	126	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.62e-10	3	402	186	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS59059.1|AA3_2	5.67e-308	1	422	1	422
QSS75262.1|AA3_2	1.29e-286	1	411	78	488
QDS77604.1|AA3_2	7.32e-132	3	411	196	608
CAE7030486.1|AA3_2	2.60e-103	4	404	199	606
ATZ53654.1|AA3_2	1.78e-102	4	411	208	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6O9N_A	4.91e-64	4	411	215	636	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
6ZE2_A	5.11e-63	3	401	172	570	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3FIM_B	3.40e-34	19	412	189	560	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	4.57e-34	19	411	188	559	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
4YNT_A	1.16e-31	5	411	177	562	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.78e-55	3	391	204	591	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	7.38e-47	19	402	236	604	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	7.38e-47	19	402	236	604	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	5.69e-35	25	392	241	608	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|P0DO29|ERIK_HERER	5.84e-35	4	411	203	593	Dehydrogenase eriK OS=Hericium erinaceus OX=91752 GN=eriK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000017

TMHMM  Annotations     

There is no transmembrane helices in HCAG_01268-t26_1-p1.