CAZyme Information: HCAG_00273-t26_1-p1

Basic Information

• Species: Histoplasma capsulatum
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Histoplasma; Histoplasma capsulatum
• CAZyme ID: HCAG_00273-t26_1-p1
• CAZy Family: AA11
• CAZyme Description: predicted protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453		51628.06	9.2920

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_HcapsulatumNAm1	9402	339724	89	9313

• Gene Location: location=CH476655:898632-900126(-)

Full Sequence      

MILLGLSSRYFTFVTIAILLIIAILYGSFSHVYSGPLSYLPKSQSQLPLCRASSPAAGSD
NNNSKVGACIGVKPWKFETTHDGDNYGLSRAQCQQAFPKLYIEIEKAVAARRGRNITFDE
LNSKPLKNSMVRAMIYQGALYVINFEDMRYTFSRAKASLNALNRALNAVPNRYEIPNIEF
IFTTEDYHDDPHPIWVYSKRETNGWAWLMPDFGYWSWPEIKAGQYRSIRQRIAAIDEGAI
INGKPRTALRFQRKKKQLLWRGAIATAPVLRQKLLDVTKGKSWASVRALNWADETSMRDD
YIPIEDHCKYMFLAHVEGRSYSGRGKYLQNCRSVMVAHQLVWREAHHGALVATGPEANYV
KVRRDFSDLEAKMNYLLDNPEVAEKIAENGVRTFRDRYLTPAAEACYWRELIHAYASMCD
FEPVLYADASGEPSSVRGVPFESFVLDWKLPGK

Enzyme Prediction     

No EC number prediction in HCAG_00273-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	176	419	8.9e-29	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	1.48e-19	98	429	7	333	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	3.32e-14	174	416	1	250	Putative lipopolysaccharide-modifying enzyme.
404418	Glyco_trans_1_2	0.002	364	398	48	82	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS64975.1|GT0	0.0	1	453	1	453
QSS70846.1|GT0	0.0	1	453	1	453
BCS13796.1|GT0	2.39e-165	75	446	68	439
BCS02108.1|GT0	2.39e-165	75	446	68	439
UDD61446.1|GT0	1.58e-162	68	446	57	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	2.49e-13	175	421	94	344	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	1.30e-09	175	422	128	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	1.24e-12	124	422	84	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	1.58e-12	175	421	122	372	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	1.19e-11	175	421	122	372	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1
sp|B0X1Q4|RUMI_CULQU	1.25e-11	170	422	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	8.86e-11	175	421	122	372	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984581	0.015432

TMHMM  Annotations     

Start	End
13	35