CAZyme Information: H310_14687-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14687-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	KI914032|CGC1	31089.87	6.6746

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914032:46229-47159(+)

Full Sequence      

MHVRSLVAVAASVLVESANAVNICNALTPGSWTQAANANPQLQGALNELSKYAVATWYTD
RWGDAVNDLLQKCTGSQVPSIVIYGLPNKDCADGFSSGGTNKDAAMYKAWVQSLVARVGS
REVVYVLEPDAIGLLSNNYCAKQFNYLDNLKLALGLISAGNPNAKVYADVASWANIAEAT
KVLNELKSAGRLHGVTINTSNYKTNGQLLSFCSAISSATGGLRCVFDTSRNHRGSVGDEW
CNSRSAGIGAPPGSDTGNALVDFNLWLKVPGESDGECNGRTPDARVGPSAVGLWT

Enzyme Prediction     

No EC number prediction in H310_14687-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	31	278	5e-56	0.95578231292517

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	3.68e-38	39	278	1	288	Glycosyl hydrolases family 6.
227616	CelA1	2.79e-17	72	284	179	395	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55493.1|GH6	1.93e-105	23	290	21	283
AIG55776.1|CBM1|GH6	2.39e-102	9	290	7	282
AIG55789.1|CBM1|GH6	3.48e-102	6	290	1	280
AIG56131.1|GH6	1.37e-101	23	290	23	285
AIG55792.1|GH6	5.05e-101	8	290	8	285

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	1.23e-38	27	275	11	266	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
2BOE_X	2.59e-37	27	275	11	266	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
1UP0_A	2.78e-33	35	284	22	277	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	2.78e-33	35	284	22	277	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	4.33e-33	35	284	43	298	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	1.36e-36	27	275	42	297	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	2.30e-33	32	275	50	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	1.41e-29	77	279	141	343	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P07984|GUNA_CELFI	1.84e-29	45	294	195	436	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P46236|GUNB_FUSOX	6.52e-19	72	275	172	417	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999685	CS pos: 20-21. Pr: 0.9660

TMHMM  Annotations     

There is no transmembrane helices in H310_14687-t26_1-p1.