CAZyme Information: H310_14678-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14678-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
839		92738.16	7.3035

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914032:7853-11275(-)

Full Sequence      

MRFIVDVVASFTPAATHRVCVLGNVPELGAWDPRHAVLLQRQDGSTTWTAHVDVRTSTAI
EYKYAITSIRDNAFVVWESLPTNRSLDPGQLVRSQREMASLGDDDVEVHDGWFGLDTSDL
GDCSKLHVEARHVAAPQTRLVFGSLVGRAPITLFDAPRANVHVAVRIPREATAQQGDITL
WPHTTSFRHAVDTSVPLHALHAKLLGNSTHHYSLHHAGGAPPNDIDALREMPVFMTLDDH
VLADVAAALDHVSFQPGQDIVVPGQPRRYCHWITQGHADVCGQRTTEGQHVYLQLTPRSY
FGEMALFGGVDRTSHIRVSNNDLLSCVRLDRAAFLTILAKHGLCHHALLQPYVQRLAAQQ
PQLRQLVSGPSCEAAPMPPLDDASLQVFTIHGTPAYFRLDIMAHPSNDLVGSCMITRSQV
AMDSKQSQGILTCPILAPGQHHVVVGEAAFQYLHVRPHIHPANAVHASKPALENGLPAHA
TSGVALDIGHRGLGRSYYQKLGHRVSSIRENTLPSFMIAGFSGADMVEFDVQLSKDCVPI
VYHDFFFKAKLGTRVAAATVMTKMGLHDLTLAELNQIEWRHCVEPTPSRLRSLVRKHMPS
LVGRCRMPTPQRRAIAPTTPRDADRIDMPDLAPSMQALCDAFPTLRLALDHVPLYVGFNI
EIKYPMELENRHLCALPAFELNAYVDAILDVVFECGRSRHIVFSCFAPDVCVLLRAKQTK
HRVLFLTCGTNMEPHVWDKRCIAIEHAVAFSQLEGLHGIVTNSDPLLESPQLIPAIKNNT
TLSVFTWGDQNTSHPHVQRQKMYGVDGVISDNIGDLTLRDRKRRPRDTIAVPAYAAAPL

Enzyme Prediction     

EC	2.4.1.25:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM20	16	87	1.3e-16	0.7555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
176514	GDPD_GDE5_like	1.07e-93	486	813	1	293	Glycerophosphodiester phosphodiesterase domain of mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in mammalian glycerophosphodiester phosphodiesterase GDE5-like proteins. GDE5 is widely expressed in mammalian tissues, with highest expression in spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols.
176549	GDPD_GDE5	3.30e-71	486	813	1	290	Glycerophosphodiester phosphodiesterase domain of putative mammalian glycerophosphodiester phosphodiesterase GDE5 and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in putative mammalian GDE5 and similar proteins. Mammalian GDE5 is widely expressed in mammalian tissues, with highest expression in the spinal chord. Although its biological function remains unclear, mammalian GDE5 shows higher sequence homology to fungal and plant glycerophosphodiester phosphodiesterases (GP-GDEs, EC 3.1.4.46) than to other bacterial and mammalian GP-GDEs. It may also hydrolyze glycerophosphodiesters to sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. In addition to C-terminal GDPD domain, all members in this subfamily have a starch binding domain (CBM20) in the N-terminus, which suggests these proteins may play a distinct role in glycerol metabolism.
176548	GDPD_YPL110cp_fungi	1.83e-53	483	814	1	278	Glycerophosphodiester phosphodiesterase domain of Saccharomyces cerevisiae YPL110cp and similar proteins. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in Saccharomyces cerevisiae YPL110cp and other uncharacterized fungal homologs. The product of S. cerevisiae ORF YPL110c (GDE1), YPL110cp (Gde1p), displays homology to bacterial and mammalian glycerophosphodiester phosphodiesterases (GP-GDE, EC 3.1.4.46), which catalyzes the degradation of glycerophosphodiesters to produce sn-glycerol-3-phosphate (G3P) and the corresponding alcohols. S. cerevisiae YPL110cp has been characterized as a cytoplasmic glycerophosphocholine (GPC)-specific phosphodiesterase that selectively hydrolyzes GPC, not glycerophosphoinositol (GPI), to generate choline and glycerolphosphate. YPL110cp has multi-domain architecture, including not only C-terminal GDPD, but also an SPX N-terminal domain along with several ankyrin repeats, which implies that YPL110cp may mediate protein-protein interactions in a variety of proteins and play a role in maintaining cellular phosphate levels. Members in this family are distantly related to S. cerevisiae YPL206cp, which selectively catalyzes the cleavage of phosphatidylglycerol (PG), not glycerophosphoinositol (GPI) or glycerophosphocholine (GPC), to diacylglycerol (DAG) and glycerophosphate, and has been characterized as a PG-specific phospholipase C.
176547	GDPD_GDE5_like_1_plant	2.67e-48	488	813	3	282	Glycerophosphodiester phosphodiesterase domain of uncharacterized plant glycerophosphodiester phosphodiesterase-like proteins similar to mammalian GDE5. This subfamily corresponds to the glycerophosphodiester phosphodiesterase domain (GDPD) present in a group of uncharacterized plant glycerophosphodiester phosphodiesterase (GP-PDE)-like proteins. Members in this family show very high sequence homology to mammalian glycerophosphodiester phosphodiesterase GDE5 and are distantly related to plant GP-PDEs.
397241	GDPD	6.24e-33	490	814	1	243	Glycerophosphoryl diester phosphodiesterase family. E. coli has two sequence related isozymes of glycerophosphoryl diester phosphodiesterase (GDPD) - periplasmic and cytosolic. This family also includes agrocinopine synthase, the similarity to GDPD has been noted. This family appears to have weak but not significant matches to mammalian phospholipase C pfam00388, which suggests that this family may adopt a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7079715.1|CBM20	6.46e-52	425	836	333	693
CAD7239979.1|CBM20	8.58e-50	425	813	291	628
AEY56806.1|CBM20	1.29e-49	486	822	368	663
AEY56804.1|CBM20	1.88e-49	486	822	404	699
AEY56805.1|CBM20	2.65e-49	486	822	368	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KJY_A	3.15e-09	228	338	19	128	Co-crystal structure of PKA RI alpha CNB-B mutant (G316R/A336T) with cAMP [Homo sapiens],5KJZ_A Co-crystal structure of PKA RI alpha CNB-B mutant (G316R/A336T) with cGMP [Homo sapiens]
5KJX_A	5.82e-09	228	338	19	128	Co-crystal Structure of PKA RI alpha CNB-B domain with cAMP [Homo sapiens]
4DIN_B	1.71e-08	228	338	250	359	Novel Localization and Quaternary Structure of the PKA RI beta Holoenzyme [Homo sapiens]
4X6R_B	3.17e-08	228	338	159	268	An Isoform-specific Myristylation Switch Targets RIIb PKA Holoenzymes to Membranes [Bos taurus]
2QCS_B	3.20e-08	228	338	159	268	Chain B, cAMP-dependent protein kinase type I-alpha regulatory subunit [Bos taurus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80VJ4|GPCP1_RAT	7.90e-42	410	815	252	613	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Rattus norvegicus OX=10116 GN=Gpcpd1 PE=1 SV=1
sp|Q8C0L9|GPCP1_MOUSE	1.15e-40	410	815	255	616	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
sp|Q9NPB8|GPCP1_HUMAN	1.50e-40	410	815	252	613	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens OX=9606 GN=GPCPD1 PE=1 SV=2
sp|Q9C104|GDE1_SCHPO	3.25e-39	481	813	744	1059	Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
sp|Q21407|GPCP1_CAEEL	5.99e-38	486	815	345	649	Putative glycerophosphocholine phosphodiesterase GPCPD1 homolog 1 OS=Caenorhabditis elegans OX=6239 GN=gpcp-1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000017

TMHMM  Annotations     

There is no transmembrane helices in H310_14678-t26_1-p1.