CAZyme Information: H310_14533-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14533-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804		87265.69	6.1447

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914024:94337-97135(-)

Full Sequence      

MARLVHLKASFGAFVVACCFLYSAQVHHLAPRAAPSLNAVHLANLDATGTRDEVASLVSS
LSTSQKVGQLLQVDIRKLFDGGDDWSQTAPILNKTRVAEYAKLGIGSFFNTPFDGRTQTQ
APTVTHWRSILHDIHVVYAEHGAVPFVYGIDTTHGANYIQDATLFPQPLAAASSFNVDLV
YRMGQVAAKDTLAAGIPWVFSPVVGIAAQPKWSRNYETFGEDPHAVSVLGVALIQGLQAS
NATAACMKHFIGYSNPTSGNDRADSVISDFELVNYYAPPFLAAVQQGRVKSAMETYTSVN
GEPVIASHKLLVKLLRHDMGFDGLLVTDENEIHQLEAEHHAADSDLDAIYTVFNHTSVDM
NMLPSLADVHNLTWSLVEQGRISTERLDESVRRILQMKADMGLLASYSQGNFTWTDATLT
ATVGAVEDQRDAKALADEAIIVLENSPKIPIDAVNPKYTLPIEDPQAAVFLTGPLADSKA
FLCGGWSIFWQGTDNSTMIPHGMSIREALNHSFANLQYAAGVDTYGHAVGNLTEALETAA
MSTYTIVVVGEAPYAEKNGDIDELSLPDGQLQYVRNLTAIASTNVILVVVEGRPRLLRGV
HKNAAAVVVSFLPCEQGGQAIADVVTGRVNPSAKLPITYPKASGDVHLPYFHRVNSKCRE
GFQECAMEWTFGSGLSYTTFEYSDMTLSDSTVHSNGTLTLSVTVTNSGRRAGKEVVFVFI
SQKVRHGAVPEVKRLKHFTKVSLQPQESTTVRFTLTAVDWSYYAPQIGSGFHAVSEPGQF
DVLVKHDTDCGKHPALCKTFHVVA

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	143	347	4.4e-58	0.8935185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.85e-103	29	788	15	754	beta-glucosidase BglX.
224389	BglX	1.16e-62	61	489	1	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.30e-50	23	755	23	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.32e-49	62	395	1	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.76e-32	459	677	10	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27116.1|GH3	2.70e-205	92	790	16	705
CCA27737.1|GH3	1.50e-198	54	790	68	789
UIZ29009.1|GH3	1.59e-191	31	800	12	756
UIZ29613.1|GH3	6.68e-189	53	790	73	801
UIZ29432.1|GH3	5.26e-188	53	790	28	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.87e-105	58	762	21	721	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	3.56e-77	144	784	84	737	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.80e-76	144	784	84	737	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5P_A	8.58e-73	29	788	14	754	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5I_A	9.27e-73	54	788	7	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	2.63e-141	44	784	69	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.77e-104	58	762	43	743	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.55e-78	54	788	38	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	7.85e-78	54	788	38	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	4.97e-70	142	784	64	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.485343	0.514653	CS pos: 17-18. Pr: 0.3219

TMHMM  Annotations     

There is no transmembrane helices in H310_14533-t26_1-p1.