CAZyme Information: H310_14114-t26_3-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14114-t26_3-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761		83727.56	6.0944

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914012:107809-110449(-)

Full Sequence      

MQWRHVLLVLVLRIVPVECRRARQPPLHDGGNDGCTLDFGVGRLTMPCRAADFGEFVSTR
AEDIRVVTAAPIHACPGLTIDAAPEMAGDDRALFVVHRGACSFADKVRQVKQWGGRYIVI
VNSDNSFLRMQSPDWVDASVVAVSVRHDDGTRLIEYAQNIAAAPLSPFAITHPMSGYALC
LDRIASLLQINAPRTAADTFAHCAPHTTFPPTSDDLVLPNEEIAGFYSRVAALFQASGFQ
FTDFVRLPMLEASYFALHCAVTPTPVVHNRLASAYLETGNFFLAAEHFVQAVRGTNDGGG
AASCDAALAYFLDGNYASSLEWYSTCQTTQGAAAHHFPPLYNTPASSLRQLFATPLAAAD
KACLAATWPAPLDSTCCIATLDDQQRVTWTFQSPFVQFLFETYTLVGVFLDELGAFNSSL
VHFTLGHHLCGPASGLHIRAATAIPIVFDSDDDMHVFLAEFASRVGRLNRTGVDADVAGN
IRAEHAAYLKWTITPPTMFVGYQGVDVAHLQVAVASMYQRLYPSLARPLEMPPPPPLDTR
QTKIKVGFVSSWFRVHSVGKLIQRVIETIDRNQFHVVVLAATHFFPHDTVATSTTTDAIT
RAIQEAADAFVVLPASQDMAMHMILQEALDVLVYPEIGMDAWMYFLAHRRLAPIQCMFWG
HPITTGLPSIDYFIASEFFFADFFESNDGRRMDEMHGGATYTEQLVLFSDLSTYFSKPRA
LPPVDDAVAASMRATLHLPASGRIYLCPQVDCRRHTWIAIE

Enzyme Prediction     

No EC number prediction in H310_14114-t26_3-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.39e-12	543	760	259	453	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
239042	PA_hPAP21_like	7.75e-06	52	126	1	70	PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa). This group contains various PA domain-containing proteins similar to hPAP21. Complex N-glycosylation may be required for the secretion of hPAP21. The significance of the PA domain to hPAP21 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
239041	PA_EDEM3_like	1.66e-04	65	126	20	77	PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins. This group contains various PA domain-containing proteins similar to mouse EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein). EDEM3 contains a region, similar to Class I alpha-mannosidases (gylcosyl hydrolase family 47), N-terminal to the PA domain. EDEM3 accelerates glycoprotein ERAD (ER-associated degradation). In transfected mammalian cells, overexpression of EDEM3 enhances the mannose trimming from the N-glycans, of a model misfolded protein [alpha1-antitrypsin null (Hong Kong)] as well as, from total glycoproteins. Mannose trimming appears to be involved in the selection of ERAD substrates. EDEM3 has a different specificity of trimming than ER alpha-mannosidase 1. The significance of the PA domain to EDEM3 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
238300	PA	4.55e-04	49	128	8	84	PA: Protease-associated (PA) domain. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following: i) various signal peptide peptidases including, hSPPL2a and 2b which catalyze the intramembrane proteolysis of tumor necrosis factor alpha, ii) various proteins containing a C3H2C3 RING finger including, Arabidopsis ReMembR-H2 protein and various E3 ubiquitin ligases such as human GRAIL (gene related to anergy in lymphocytes), iii) EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein), iv) various plant vacuolar sorting receptors such as Pisum sativum BP-80, v) glutamate carboxypeptidase II (GCPII), vi) yeast aminopeptidase Y, vii) Vibrio metschnikovii VapT, a sodium dodecyl sulfate (SDS) resistant extracellular alkaline serine protease, viii) lactocepin (a cell envelope-associated protease from Lactobacillus paracasei subsp. paracasei NCDO 151), ix) various subtilisin-like proteases such as melon Cucumisin, and x) human TfR (transferrin receptor) 1 and 2.
404688	Glyco_transf_41	0.002	543	674	80	203	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55953.1|GT41	2.25e-141	22	756	22	706
QDT74414.1|GT41	1.09e-35	437	755	511	779
BBO34148.1|GT41	1.40e-34	432	755	508	781
QQP88850.1|GT41	6.30e-34	404	749	379	678
BAP54338.1|GT41	1.53e-33	434	755	135	416

PDB Hits     

H310_14114-t26_3-p1 has no PDB hit.

Swiss-Prot Hits     

H310_14114-t26_3-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999781	CS pos: 19-20. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in H310_14114-t26_3-p1.