CAZyme Information: H310_14114-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14114-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
963		105984.34	6.5834

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914012:107054-110449(-)

Full Sequence      

MQWRHVLLVLVLRIVPVECRRARQPPLHDGGNDGCTLDFGVGRLTMPCRAADFGEFVSTR
AEDIRVVTAAPIHACPGLTIDAAPEMAGDDRALFVVHRGACSFADKVRQVKQWGGRYIVI
VNSDNSFLRMQSPDWVDASVVAVSVRHDDGTRLIEYAQNIAAAPLSPFAITHPMSGYALC
LDRIASLLQINAPRTAADTFAHCAPHTTFPPTSDDLVLPNEEIAGFYSRVAALFQASGFQ
FTDFVRLPMLEASYFALHCAVTPTPVVHNRLASAYLETGNFFLAAEHFVQAVRGTNDGGG
AASCDAALAYFLDGNYASSLEWYSTCQTTQGAAAHHFPPLYNTPASSLRQLFATPLAAAD
KACLAATWPAPLDSTCCIATLDDQQRVTWTFQSPFVQFLFETYTLVGVFLDELGAFNSSL
VHFTLGHHLCGPASGLHIRAATAIPIVFDSDDDMHVFLAEFASRVGRLNRTGVDADVAGN
IRAEHAAYLKWTITPPTMFVGYQGVDVAHLQVAVASMYQRLYPSLARPLEMPPPPPLDTR
QTKIKVGFVSSWFRVHSVGKLIQRVIETIDRNQFHVVVLAATHFFPHDTVATSTTTDAIT
RAIQEAADAFVVLPASQDMAMHMILQEALDVLVYPEIGMDAWMYFLAHRRLAPIQCMFWG
HPITTGLPSIDYFIASEFFFADFFESNDGRRMDEMHGGATYTEQLVLFSDLSTYFSKPRA
LPPVDDAVAASMRATLHLPASGRIYLCPQTLMKLHVAFDQAILGLLKLDTDGHVVLLYSP
KQLLWKDKVHRRLGRTLGNRLVRRVLFVATLPHDKFMQLLAIADVMIDPFPFGGGVTTLD
AFAAGLPVVTLPSRQSVLQLTAGFYRYLSLSTHLIASNLDEFVAHAVAIATNSTLKLALQ
QTIHDRLHDRFDIPDDGPHEWNTFLANVVMSSTNGSPRFSAMVTRKDGTDLDRASSKIHR
HVG

Enzyme Prediction     

No EC number prediction in H310_14114-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	264	907	4.5e-60	0.5205673758865248

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	7.60e-29	543	903	259	588	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
239042	PA_hPAP21_like	8.97e-06	52	126	1	70	PA_hPAP21_like: Protease-associated domain containing proteins like the human secreted glycoprotein hPAP21 (human protease-associated domain-containing protein, 21kDa). This group contains various PA domain-containing proteins similar to hPAP21. Complex N-glycosylation may be required for the secretion of hPAP21. The significance of the PA domain to hPAP21 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
223515	RfaB	1.89e-04	804	913	258	363	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
239041	PA_EDEM3_like	2.18e-04	65	126	20	77	PA_EDEM3_like: protease associated domain (PA) domain-containing EDEM3-like proteins. This group contains various PA domain-containing proteins similar to mouse EDEM3 (ER-degradation-enhancing mannosidase-like 3 protein). EDEM3 contains a region, similar to Class I alpha-mannosidases (gylcosyl hydrolase family 47), N-terminal to the PA domain. EDEM3 accelerates glycoprotein ERAD (ER-associated degradation). In transfected mammalian cells, overexpression of EDEM3 enhances the mannose trimming from the N-glycans, of a model misfolded protein [alpha1-antitrypsin null (Hong Kong)] as well as, from total glycoproteins. Mannose trimming appears to be involved in the selection of ERAD substrates. EDEM3 has a different specificity of trimming than ER alpha-mannosidase 1. The significance of the PA domain to EDEM3 has not been ascertained. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate.
340831	GT4_PimA-like	3.86e-04	545	913	1	354	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55953.1|GT41	4.14e-205	22	928	22	874
BBO34148.1|GT41	8.79e-65	432	903	508	926
QDT74414.1|GT41	3.25e-63	437	903	511	924
UEM20219.1|GT41	2.83e-59	431	912	236	669
QQP88850.1|GT41	4.64e-59	404	912	379	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3E_A	1.41e-13	635	903	356	599	Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3E_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
5DJS_A	3.20e-12	508	889	113	475	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
2JLB_A	7.24e-11	544	903	206	533	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	9.54e-11	544	903	206	533	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B3H2N2|NGT_ACTP7	1.79e-13	635	903	345	588	UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) OX=537457 GN=APP7_1697 PE=1 SV=1
sp|A3N2T3|NGT_ACTP2	7.12e-13	635	903	345	588	UDP-glucose:protein N-beta-glucosyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) OX=416269 GN=APL_1635 PE=1 SV=1
sp|Q9M8Y0|SEC_ARATH	2.02e-09	543	903	591	925	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q96301|SPY_ARATH	3.40e-09	537	905	476	816	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
sp|O82039|SPY_PETHY	1.18e-07	541	905	485	821	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000205	0.999781	CS pos: 19-20. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in H310_14114-t26_1-p1.