CAZyme Information: H310_14082-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_14082-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
937		103578.40	8.4220

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914012:3415-6228(-)

Full Sequence      

MGVLRAVGWTIGVIATVASLVVIGYMAAEQRMDAIRKYGMVIHEFDPWFNFRAAVYLADN
GYERFFKWYDYMSWYPLGRPVGTTIYPGMQIVSVTAWELLNKAGISISLNDVCCLTPVWG
GVFATLTLSALTYVCTGRVTAALVSGWVMSIIPAHLMRSVGGGYDNESVAVSCLLLTFLF
WCVSLKSSDDSKATYVGVLTGLAYIAMAATWGGYIYVLNMIGLHAFVLVLLGRYSNKLYW
AYSIWYIIGTIGAMQVPVIGKAPLRSLEQLAPLLVFFGLQGLKICHHPVFLKKVFNIDAA
KATRANMFLVYSVVAGVGLAILAVVVQMLWPTGYFGPLSSRIRGLFVQHTRTGNPLVDSV
AEHQPVKNDAFWQFLHATCYTAPVGLAIVVGQSVLKPWISGKDARSDPLTFVVVYSAVTY
FFSTKMNRLMLLMAGPASIATGVVGGYALDFVFAETADLVQAIVGDDGTPVDVAAEAKKD
DDKKAKKKAKAKEAAVDSPSTMSKSYNSGTVKLLRKVAATVLVAVSYQYVVQFYQYTQMM
KAPLSGPSITFEAQLRSGEKIIVDDYREGYHWLRDNTPQDARVMAWWDYGYQITGIGNRT
TIADGNTWNHEHIALLARCLTSPEKRAHNLIKHLADYVLIWAGGGGDDLAKSPHLARIGN
SVFEDICPGDPVCSNFGFYSQNNPTPMMKKSLLYRLHQHGINPQVNVDPNRFRMVFQSKY
GLLRIFKVVGVSDESKKWIEDPANRLCDAPGSWYCTGQYPPALADTLAKRKSFKQIEDFN
IAQDEKSKKYHEEYLNRMEGKAASAKSGAVPVSDDDEDEASPLPPTKMVGCYGTENSFEQ
KTYVGGQSGAYYGHALHHAVEAKAKYFAIARGDHDGHSFVFHKLKSTGKWKHSKDCERPC
LDDGSKACGCMDGACTEPKMDGEEHNRRWIVYEVLKM

Enzyme Prediction     

EC	2.4.99.18:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	14	659	5.1e-135	0.7835497835497836

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	4.05e-50	16	463	3	423	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	5.32e-39	20	614	25	573	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO63744.1|GT66	6.49e-245	12	764	22	784
CAM72022.1|GT66	2.82e-230	31	797	19	777
CAC9543585.1|GT66	1.66e-229	31	797	73	831
SYZ69400.1|GT66	2.79e-229	9	798	64	848
CAM43324.1|GT66	2.79e-229	9	798	64	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6C26_A	2.29e-111	27	728	28	682	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]
6FTJ_5	6.15e-104	26	696	29	642	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	7.72e-104	26	696	29	642	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	7.72e-104	26	696	29	642	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	2.59e-103	29	728	86	772	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94335|STT3_SCHPO	9.58e-113	20	728	29	715	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=stt3 PE=3 SV=1
sp|P39007|STT3_YEAST	1.18e-110	27	728	28	682	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STT3 PE=1 SV=2
sp|P46975|STT3_CAEEL	6.89e-106	16	696	21	663	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit stt-3 OS=Caenorhabditis elegans OX=6239 GN=stt-3 PE=1 SV=1
sp|P46978|STT3A_MOUSE	1.46e-103	26	696	29	642	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
sp|F1PJP5|STT3A_CANLF	2.04e-103	26	696	29	642	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999800	0.000231

TMHMM  Annotations     

Start	End
6	28
112	134
139	161
168	185
195	217
238	259
269	291
308	330
373	395
429	451