CAZyme Information: H310_13699-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_13699-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920		99837.25	6.9123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914006:197229-200873(-)

Full Sequence      

MARLALISTVLFGAALAPAALAQSNDTNGTTIIAPLDAVPPIVIAPAVANVDMLASPTLL
LEKSTDQSWLAPPRNLHPSVLASGIPIPTNRWWGNLISTGKDVKEVLRVWTNPYAVAMLP
TGIQVSYPAATRAFGGASGNPGASRYYLHGAQNDLTLSAAEFSSLAAEATSANFQVTSWD
DLGVTVRKDVGAAASMTSVFVSGMAFATATYVSLVPALTTQHAIQSVNGRALKEGEAVSG
TKFVVALANGQTWVVYASMEVSLAAHLTTQLVAATSFSGTLQVALAASATDIAVYDSYRD
CAVQGGTVVPATTSYTFRWATTGVCAAGLLHFALLHHADTMDGATARQVNLTHLASTTRG
AMVPFVSATATWTLQEPKLVSAGMFPRQRPTAARVTATDMRRHLTDDIHAPWTLPLDGSY
YFNGKAAQKYASLCLMAADPAVSSDATLLATCRGKLEKLLAPFASNAWTYKLVYDAVYKG
IVSSQGFVQKDLNADFGNTMYNDHHYHFGYWIATVAIANAVHPTMASLPQLNQLAALLAR
DVANDNGADTAFPTFRMFDWFRGHSYSHGVTALADGKDQESSSEEVNFHYGLMLFGQAVG
NANVERLGRLMLTLNARSIQMYFLMDSANRIHPPAIRANKVTGIYFDNKVDYATWFSSER
HCIHGIQMIPVSPATEFVRTTRFVQEEWTDILAHTAIVKQNTESNPWLSLLLTNYAAINP
DDAMKKLQTAAMDDGSRQNEALAAPVMTRRQRKTTNLALPELALPTKRRARVNLPDASTT
MSSREDTDSTTFDHDDQIVLLLDKLTTRRRRKPELPAGVKLVNPHYSSGTDEDDMEEADT
PGVGQGFPPSLRTLEKDTALMKKQYPGLSVDVIEQVLVDTIPKQENQHSYNSILTEAAAR
LEKLHNEVVMARRRTLRHID

Enzyme Prediction     

No EC number prediction in H310_13699-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	84	738	1e-167	0.9630225080385852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	7.65e-132	418	737	29	345	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	5.30e-120	28	723	10	725	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.26e-48	77	379	1	310	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56018.1|GH81	5.08e-265	60	742	72	749
AIG55599.1|GH81	9.46e-260	60	742	74	748
AIG56513.1|GH81	2.56e-234	59	742	84	763
UIZ20873.1|GH81	7.75e-211	54	742	88	786
UIZ20868.1|GH81	3.09e-210	54	742	88	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.36e-85	83	742	37	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.52e-85	83	742	62	737	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.04e-80	83	742	37	712	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.01e-22	502	720	414	627	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.48e-18	499	734	436	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.05e-82	73	723	17	672	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	9.13e-74	86	733	225	882	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.67e-64	193	736	180	725	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	6.28e-62	73	734	447	1122	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	7.91e-61	64	736	407	1094	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000281	0.999660	CS pos: 22-23. Pr: 0.9776

TMHMM  Annotations     

There is no transmembrane helices in H310_13699-t26_1-p1.