CAZyme Information: H310_13675-t26_5-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_13675-t26_5-p1
• CAZy Family: GT60
• CAZyme Description: trehalose-phosphatase, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		102261.60	7.1737

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914006:137405-140196(-)

Full Sequence      

MPPPPRPMSTPPQSPRNSSPRETTVVVCINVLPLVFSRASLTESCPWHVEWSTSSYGLFL
RNIVSKQGYKPMFIGCPEVYIPKSDEQSVRMLLLHSFNCIPVFLDTTVAHRHFQGFCKGV
LWPIFHNVVDVYNSAELKLDDFTEMSPSTPVQVQPAPPDPGVWLPPASWNPASQDKCWSE
YCHVNRLFAKKVIENWQPGSVIWIHDYPLLVLASYLLRKLRGGGALALFMHVPFPSSEIF
RTLTVRTELLRAMLCANHIGFLVFEHARHFLTACKRLLGLDYRTSHTGMLAVEYNGRLVL
ITCSHCGTELNHMRDLLGKLDSDARAVALQSSFAPLLTEGDPRRKKYILASVDRLEGLCG
VPLKLRAFDRFLSMYPMRRKDTVLVQFGISLDCRPNDYHRTQQYVEKFVAEINRRWGAPS
NPVVIYEERVHMQAQERMVLWRLGHVFLDTCVRGGLSMLPFEFLAAHHQHPDDDPGVVVV
SEFACYSRILNGALLVNPWKADDVVAALVKAVEMPPYEMHSRFALNFKFLLDNPVSDWGG
RMLADIEKAGMPALPSSPNADGTGDMVEVGFGFDYRVVQFSPGFAALCVDDTVRAYAIAS
RRLLVFDYGGTLSWTQCVMDDGAPMYLYHDGPAGRAVVDPEARLASVRKRDGQVRTPVSI
ETKASLELLCHDPCNVVVVWSNGRRVELEHEFGSIAGLHLISDSGYFLRKADSLAWESLY
ADSADDFAWKHQVTNVVKTYVSRTNGSFVIENDTSVTFDYHSSDPEYGEMQAAELYEQLS
HVLKKDKVAIARGKGFVEVHRFGVNKAIAISMVLSFCKDKVDLVPDFILCIGDDESDEPA
FKSTCGGDETMRMVANVSRRVGGVAIRAFAEAEKLPHVLTCTVGKKPSTAQCYVVTLAVS
WNRRHSGRCARIV

Enzyme Prediction     

No EC number prediction in H310_13675-t26_5-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	21	548	4.8e-112	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177855	PLN02205	2.83e-137	15	894	52	831	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
340820	GT20_TPS	8.52e-116	25	547	2	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	2.73e-109	25	547	3	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	1.19e-102	69	843	41	689	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215555	PLN03063	1.44e-94	16	832	7	707	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27356.1|GT20	1.75e-160	22	894	21	816
CCA19238.1|GT20	2.33e-155	74	894	323	1063
UIZ24099.1|GT20	2.91e-145	25	894	292	1105
CAB4086660.1|GT20	3.25e-127	18	894	55	826
ALN13341.1|GT20	6.29e-126	18	894	54	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVO_A	6.51e-67	17	546	5	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVM_A	5.26e-65	17	548	6	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	3.58e-63	25	548	6	469	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.28e-62	25	548	6	469	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.76e-62	30	548	7	464	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O23617|TPS5_ARATH	4.02e-122	18	894	55	826	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|Q94AH8|TPS6_ARATH	2.05e-121	19	894	50	837	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 6 OS=Arabidopsis thaliana OX=3702 GN=TPS6 PE=1 SV=2
sp|Q9LRA7|TPS9_ARATH	8.89e-112	17	894	54	826	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O80738|TPS10_ARATH	5.95e-109	21	894	58	826	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	7.42e-109	21	894	56	821	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000034

TMHMM  Annotations     

There is no transmembrane helices in H310_13675-t26_5-p1.