CAZyme Information: H310_13269-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_13269-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508		57728.08	6.5633

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI914000:64045-65882(+)

Full Sequence      

MHVQGIVMAIAAALVAAETPRPQSIAFSWPENDAKKHYDETVDPLSQNIPLDPASSHLRP
PTPRVPDVFDIFVGLSTFRDGYRCGYTLFTGFTRATHPERLYFGVVDQVNPEDQRCIDAY
CAFAKQEWPDEDCKYKSHIKVDERLADDSRGPTYARHHQQKLVGDQEFCLQLDAHSIFTK
KWDEGLFMDWKATNNEMAVLSTYLHHCHEGYIKSDGTNNPPDQLPHLCTTIRGGNGCVRT
VGASMIQRPQHPQMSALWGAGLSFSKCHAEKRVPIDSHTLWMFDGEEFLRASHLWTYGYD
MYSPSTTGTVIYHNYTSVPARFENVKVDLGLKKKQEEMGVNRFKLMVGQPFQGLVDTEEW
EKYNFGTVRSFKDFLAFSGITFEEGKTDQHSCKQLHWVPYQKPAEIEAMLPGWHMYPMLH
VPEHKNSVGSVDDHDGGAATAVNNHVRQEKPANFGIEGTIEHPDQGLYTGPLAFMGFGIV
LFAVVVYTNDGMWSQTKRYFRLQHKARN

Enzyme Prediction     

No EC number prediction in H310_13269-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	70	383	2.2e-58	0.996969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	2.77e-38	70	383	1	350	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVE55543.1|GT60	3.83e-175	42	416	40	414
UIZ22573.1|GT60	1.64e-172	42	508	43	499
UIZ25301.1|GT60	2.36e-169	42	412	21	393
UIZ25379.1|GT60	1.64e-142	42	496	43	505
CCA18910.1|GT60	8.03e-36	75	400	91	412

PDB Hits     

H310_13269-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	7.43e-16	71	313	6	247	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999686	CS pos: 17-18. Pr: 0.9599

TMHMM  Annotations     

Start	End
466	488