CAZyme Information: H310_12018-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_12018-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	KI913986|CGC1	42056.73	6.4919

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913986:432095-433389(-)

Full Sequence      

MWAAAVRFICAAGTLLAAFSRGAAALSKDELCAVDIDHSKYALNLITVAKNVSSAPRILC
LVNTMSIHHTTRVQAIRDTWGQRCAKLLFFSNATDSSTPDIIQLDTQADHNHLWQKHKRT
LQYVWDHHRFDGFDWFYKSDDDAYVVVDNLQAFLRLPEVVMQQDVVPLTFGHRYKLTPDL
VDYYVVDKHLRDQFKQLTNNRWVFNSGGPGYAMNPLYVQTVVESLPLSTCLSDRYCEMLP
DDAAISFCMAWHNVYPSNTRDLNRRERWHADKPRGVYFTDVTTPTYWLVQYHDGIGGAAR
HDACCSPESVAFHYVLPPLMYHLERQLYYCRSDVDLDLPAFNARTGLAISSAILEPTPLA
VDYGPVPDL

Enzyme Prediction     

EC	2.4.1.122:25

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	1.06e-04	62	155	10	107	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56262.1|GT31	3.98e-176	22	369	20	363
AIG55842.1|GT31	2.69e-117	28	332	26	307
CCA14287.1|GT31	5.61e-107	22	362	21	368
UIZ22190.1|GT31	5.08e-104	88	354	1	276
UIZ24342.1|GT31	7.09e-50	42	329	37	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	6.17e-34	47	331	18	270	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7K237|C1GLT_DROME	1.25e-32	47	331	90	342	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q5F3G7|C1GLT_CHICK	4.35e-32	48	331	80	328	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q0VC84|C1GLT_BOVIN	8.23e-30	35	331	66	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ06|C1GLT_MOUSE	1.05e-29	37	331	68	327	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1
sp|Q18515|C1GLT_CAEEL	3.02e-29	48	331	96	347	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000305	0.999668	CS pos: 25-26. Pr: 0.8949

TMHMM  Annotations     

There is no transmembrane helices in H310_12018-t26_1-p1.