CAZyme Information: H310_11801-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11801-t26_2-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608		68295.25	6.6322

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913985:320362-322446(+)

Full Sequence      

MTMLDLRRCGAVVLALCAVADAALTPPKHDPISAVQGLISRRLGEMYLNQFELRVLPASN
AGLDVAHVSTNGGKVLLEGSSATAMAYGLKSYLRQVVHTSTDWEDHALHLPTTLPLPSSP
IRLQRQAPYTYYQNVCTVSYSQWAWSWSKWERHLDWMALQGINMPLAFTGQEKVWQATFA
QFNVTDLTDFFAGAAFLAWGRMGNIQGSWVKGPLPQSFIDDQFALQQKILARMEAFGMMP
ALPAFAGHIPTKLVELYPQAKVVRSDAWAGFRAPYTQVYLLDPTDALFVQLGAAFLKTYQ
AMYKFTAHVYQTDTYNEMDPRLDTATYLAASSSAVLRSMQTVDKDAVWLMQGWLFSFSRF
WTLPRMEHYLAPLPYESLIVLDLYAEVSPMWEKSREFFHHQWIYCVLHNFGGSLGMRGDL
ETVAAAPVRANSIARAMVGVGLTMEGIFQNYVVYDLALHMPWAPAAVNVTQYVHEFALAR
YNVVGDRTFVERAWNVLRTSVYDVRNAYGGVTKDIVCLRPRWHLVHSSFMPTELRHDPRH
IQSAWELFLGAVEASPSLERDDAFTHDLIDITRQAMSDGILKAYESLQTLVGRGGATLAE
VSAIESST

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	72	589	3.8e-167	0.7677224736048266

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.28e-164	131	462	2	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404008	NAGLU_N	7.84e-21	33	115	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.
404009	NAGLU_C	9.21e-19	472	578	1	101	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56414.1|GH89	1.47e-241	20	604	21	609
AIG56008.1|GH89	1.62e-231	19	604	15	597
AIG55486.1|GH89	7.36e-222	18	588	11	572
AIG56322.1|GH89	2.05e-181	5	578	7	582
AIG55749.1|GH89	2.15e-178	27	597	26	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.35e-118	33	589	7	558	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.95e-67	32	594	171	722	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.13e-67	32	594	179	730	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.69e-66	32	594	194	745	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FNA3|NAGLU_ARATH	3.81e-127	23	602	37	660	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
sp|P54802|ANAG_HUMAN	5.86e-119	33	589	30	581	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999775	CS pos: 22-23. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in H310_11801-t26_2-p1.