CAZyme Information: H310_11776-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11776-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		47498.57	6.6176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913985:243103-244377(+)

Full Sequence      

MVVGIGLYSMVWLAVVSRFVDSSTPRTSLASTDTTPFVLQRTPPHLNTSPTPPSLIRAIP
DDQAMHDVRGFGLATKSSPTSNPNLSLVDGVKASRTNDKEGPKPFLLDGDNDGLHSVVAP
DTTNTPQPPRDSPSTPAQRIPKIIHQSWKSADHIPSKFVQWMQSWRTHHPTWTYVFWDDS
DNLDLFEEHYSKYAPVARRVSKIQLADMSRYALLHRYGGLYVDGDFEALQPMDDLTDLPL
FLSFEPLVHSVLLEGASAPVLCNAILASMAGHPFWLEVLDNILDAFNSPGGARQDPVSLT
GPRMVQHTMSQHAKAASAATTTPGIILLDEEYFYPEVAYWNLDNLSRKCTHVKSHPPIVQ
EACAWLNEYPTGRYTNKTHAVHHWQCTWCRGDDTTSYVSLHDIFPNQDTRRPHQMHVPRT
PVRI

Enzyme Prediction     

No EC number prediction in H310_11776-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	160	236	1.7e-16	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.33e-18	140	287	82	219	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.82e-13	155	242	1	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	7.49e-04	140	223	46	131	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI10024.1|GT2|GT32|GT62	1.71e-35	140	390	7	226
QKV94833.1|GT2|GT32|GT62	3.82e-33	140	384	7	243
AQW50986.1|GT2|GT32|GT62	3.88e-33	140	399	7	235
QDZ26039.1|GT32	9.58e-33	138	388	12	288
UPR05240.1|GT32	9.58e-33	138	388	12	288

PDB Hits     

H310_11776-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14084|IMT1_SCHPO	3.52e-16	131	287	53	203	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	8.09e-16	135	332	57	243	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.90e-13	134	282	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	2.24e-13	131	282	47	186	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.06e-11	140	282	82	213	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.953404	0.046609

TMHMM  Annotations     

There is no transmembrane helices in H310_11776-t26_1-p1.