CAZyme Information: H310_11669-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11669-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	KI913984|CGC3	45638.92	5.0003

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913984:178446-179720(+)

Full Sequence      

MARLVVATFLAVMTIAMASLVDLPLCGGPVMSYGPAKATYPALADALTLVEEQPIAVWWS
DNNPTHRIEIDALFDRCNASTVPTIVVYALPNKDCHASYSNRGFINSTEQYTAFVQQLAT
LVGSRPVIYILEPDAVGLATGGGCGQDAGYLDNMQRASAVLTTNNANAMLYVDVGYWMLQ
TDDKARQIASALQVVSATSRLHSVRGIVLNTANYRPVSEITSLCARLIQVAGNPDWRCVI
DTSRNYQTPTTTTEWCNNKFGAIGIPPTRNTGFPNLVDAFLWIKIPGESDGECINRTAIA
GPMHSIDAMPGPAAAVFFPQAFRTLWNQGYFVQNNLAPVLEQDAEAMVLAQVESKTPDLA
RPDGSDAPTTQRPHLPEEPHPSKLNNQVPRPAAAILTSSSPNDSVFLTWGIHGTVVVAGA
LLAL

Enzyme Prediction     

No EC number prediction in H310_11669-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	40	293	3.7e-54	0.9251700680272109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.89e-47	41	293	2	287	Glycosyl hydrolases family 6.
227616	CelA1	7.19e-13	76	293	179	388	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	1.39e-70	25	332	24	314
AIG55789.1|CBM1|GH6	2.86e-70	25	346	18	311
AIG56131.1|GH6	1.11e-67	25	343	23	314
CCA16954.1|GH6	5.16e-66	25	332	23	320
AIG55974.1|GH6	8.58e-66	32	340	33	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	4.64e-35	41	294	27	268	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
2BOE_X	8.96e-34	41	294	27	268	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
3RPT_A	8.75e-26	41	294	26	256	Crystal structure of the anti-HIV b12 scaffold protein [Thermobifida fusca],3RPT_X Crystal structure of the anti-HIV b12 scaffold protein [Thermobifida fusca]
3RU8_X	5.48e-24	54	294	36	256	Structure of an HIV epitope scaffold in complex with neutralizing antibody b12 Fab [unidentified]
1UP0_A	2.41e-23	24	293	4	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	4.49e-33	41	294	58	299	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	7.26e-29	41	319	61	328	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	3.32e-22	50	291	107	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P07984|GUNA_CELFI	2.73e-21	36	293	189	426	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|Q4WFK4|CBHC_ASPFU	1.25e-15	41	325	121	446	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999664	CS pos: 18-19. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in H310_11669-t26_1-p1.