CAZyme Information: H310_11633-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11633-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	KI913984|CGC2	64131.01	5.6642

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913984:24975-27154(+)

Full Sequence      

MKFKKRHAEIAVGLVLLAGAFVGVLFGAGVFQDSAEVATRKAFDSAANALAPRDIACPVI
PPGKRLIQNIPSQRQGCSSVTEGVTHVVLTYADLAAKSFQLNDVDVLSCVSDLRKRCIYV
LGGIGGDKMFNTSTVAADAAAVVSKFKLDGITVHDLSKSSSTLSYMTALSASLKALNATL
SYDVYYSELDKTKLNCGTRCFAEGVQHVVDWLTVMAFSVSDDAVYAADIYADAIAGFLDP
WKAKLQNATGKLNIGVCTDCGFGPGPTSDDISIWTTYSQTAGGMSVYGSGDGMFRAIQSI
FQPKPLPIAMTRRPLSGNNSMCQSDNSSHAPRVVLYWGSEVGGCETIPPGVTHVVMTFAL
VKDGAVSLTLQGDDATLRRCVVSLQQRCIDVLVSIGGDTDNHQLAGVTDMDTFAASAVAL
VDKFNFDGVDVDDENRAGTYDQDHVVEYMAALSKALKPRGKLLTMAAFYYDSVADKCAAV
SGRCFPRQVEALVDWVNVMAYNVEKDVGKAEAVYESAITDTFAMWMAVLPPAKVVVAVCT
ESTNPLHRGCSYGPGPSPAVVAQWTKWSRENAGGMGVWAGSKDQFLNYTYTTLVTGGDAR
R

Enzyme Prediction     

EC	3.2.1.14:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	332	538	9.8e-25	0.6452702702702703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	4.58e-24	332	538	1	220	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	1.01e-20	345	503	17	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	1.33e-17	332	588	1	305	Glyco_18 domain.
119362	GH18_3CO4_chitinase	3.22e-15	351	594	23	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.
119350	GH18_chitinase_D-like	1.12e-13	336	527	6	218	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55900.1|GH18	7.20e-21	335	557	86	328
AIG56010.1|GH18	7.16e-20	335	540	95	328
SCF17131.1|CBM13|GH18	9.49e-15	306	596	14	321
ANZ41390.1|CBM13|GH18	2.69e-12	352	583	59	298
AYF28669.1|CBM13|GH18	2.83e-12	334	598	43	325

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y29_A	9.15e-06	345	536	29	245	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	9.42e-06	345	536	29	245	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]

Swiss-Prot Hits     

H310_11633-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.803082	0.196920

TMHMM  Annotations     

Start	End
12	31