CAZyme Information: H310_11534-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11534-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594		66530.75	6.7668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913983:187652-189436(+)

Full Sequence      

MKVPSAVAAAFAVSSAAALDAKFYGMNYDTRLSEWGGCKDANTMAQDMTVLKQVTDNIRI
YSMNFECTKRVLQVADNRGLKVWLGMWSEIDAPGVHDSFPSEMNNLKALVEQTQAIRNDN
VLGLQVSSEALYRYYVQGPGNVTGSSDRRGYDALVNHLNEARNYLRGRGYTFPVVITDIM
DMYTMFPDLYNVVDVVAVNQFSFWQHITPEDGTHFTFTRFQEEQTRAKRAGKLIEMHETG
WSTAGEHPVVTEASPRAQGVFTQDFLTLVARQNINTYYFSGFDLPFGSSDIEKNFGIYTT
DRVLKPAIAAVRVGAPLQAVRLWAQGNVIKVNRHWNADNTVNDNYGRVYAEKPASGRSGI
FDDEIWLWDADARILYSKSSDACLDSYGDRYQQTLHTWYCSKENRNQKWSVKNGNIASLN
DANFCIDVDLARPKTSDGKLVVKMFPCVGHPNQVISMVPAAAEPVEIGIKSSGGVLTESN
GRVSWETVRKSNADCHQWFYDPITQLIASKSYRGLCLDAYERRNGGTVHLYYCNAANANQ
KWVVNDITGQLHHATHLGFCLDGPDNANGLVHLWSCDKTNVNQKWSIKLVNATP

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	473	591	6.3e-16	0.648936170212766

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	8.77e-30	36	302	57	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.90e-16	493	585	29	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	9.62e-13	514	588	11	85	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.41e-12	509	588	5	83	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	5.79e-11	493	587	27	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55545.1|CBM13|GH17	1.53e-158	13	561	11	544
AIG55960.1|CBM13|GH17	6.52e-155	1	568	1	552
AIG56029.1|CBM13|GH17	5.05e-146	1	566	1	540
AIG56030.1|CBM13|GH17	6.29e-141	1	570	1	554
AIG55846.1|CBM13|GH17	4.90e-129	1	566	1	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.06e-29	23	308	37	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.97e-28	23	308	37	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NTP7|BTGC_ASPFN	7.43e-16	23	308	381	674	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	7.43e-16	23	308	381	674	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.28e-15	42	308	407	677	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.28e-15	42	308	407	677	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	2.13e-14	42	308	407	677	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.926379	0.073654

TMHMM  Annotations     

There is no transmembrane helices in H310_11534-t26_1-p1.