CAZyme Information: H310_11320-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11320-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2007	KI913982|CGC1	218113.68	6.1558

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913982:9447-15913(-)

Full Sequence      

MMETLESQHHEHPLVPSSIATLCQENRCYVGGAGCNVCAASCAGAWHCAACGFDLCGDCS
GTDLPPKKIDHSQHPHTLTFLSIPELNQLHANYQIVQCDLCRMPGYCSYHCESCCFDLCV
LCALQKLAPVFGALPSAAALNSVHPAATSAVDWSQYDDDNPNANQTDDSEGLENISCGKV
ASGSSMENEDSHAKFAVDGDDETRFASADSDPQWLEVDLGALHKISHVCIQWEAAYAATY
DIQVSKDRLAWTTVASVADNRGDGWVKTKLPDSEDAHATFIRMYGHARGTTYGYSIYHFN
VYGTKLTPSLERVVVTPANVALGARVVRGLHWPVTSSFDGVYGYPGTVVAYKCPDAPPVH
AENHRPYHGPDKCCIVKWDLITTPAVHRIGAAGQYELYFHPEHAPADATTDVPDDAIHEL
HGLECLVKSPAQTDGVDELRTLESTLWPTSRDTRHEWKEKLAVRPPQTSKDLDEALVGRV
LQGKLVASDIVQKPKAISVFVSSTFTDTASERNLLIADVYPYLKRYAALLGLEFSASEMR
WGIRDEASNSHQTSAICMAELARCQTSSLGLNYVLILGNKYGYRPFPNQIPLDEFEALVA
TMATSDADVVRHWFRINTNVIPPAMELQPSTLAAPGTWWPIFEQMQRAFRNVRHVVSDPH
RQDLYNVSVTECEVMHGLLTAADAKTAAFVYHRIIPDIDSSHGKAGMYVDMAGRGQIDDE
AQALLATLRDTKVKPKQHGAKEYTVPWGPEILPETHATYLTDFCDHFCSHMCESLLAASE
QLNVAPDAVFNEVMHHALFCAQRSANFVGRADILSKVHAYLRSATVENRPFVLYGRGGAG
KSAVVAKVAMKLTGGGGPAVAAGSGLAAVLTPRHDPVLVLRFLGTSLDSTDIRKLLTSIC
SQIHRNYSTTHGMSATIPPGLDDLIRHFHDLLALASETKPLVVILDSLDQLSSADNAHHL
TWLPMSLPPHCKLVVSALDAADEGGNCLAKLRAQTPTDHLLELPVMTSADGLDMMTAWLA
ARNRALTPHQSRFLVDSFVQCPLPLYLHVAFTLALPWTSYTPVDTALLPPTIPDLLRHLF
HKLCGVHGQLLVHHTAGYLTLAKRGLSRSELEDVLSLDDDVLNDVYQWWVPPIRRIPSLV
VTRLLSDLDSYLVTHAADGGIPVLSWYHREFNVAARAICLGDDAVVTSLSANLAAFFASD
YAHVAKPFVDKNGVPAGRAQRKVAPQELVLPGSSRGVQFNHRRVTELPSALIGAQDWPRV
EYVVSDVEFLQASVALGAIADTLSDIRRAIQAMYAADVPPTILPQVAAFLSRDMFTLQRH
PSSFYQVVMRHPKASFLRTTAAAKLTPPPQGYFQVVSTETPASSIMASFMVGPASDGADS
TVAVAFSPDSLKVAALSEPDCGQVVYLTVFDVVSNTVMWTVAEPDVKYDSVTWSVDGTSV
IVGASASGELHLFSEAIGVRTKVLHAALKKKKKHRITSVVCVNATTIVTADRTSPELHVW
ENGTIHRTLKIQGHGEDDHNDSKKMTQILLSPDRQHMGVASYSGACSIWSCATWHEEATF
EAAEGVKYASLSSDATMLAVNVDTYNGQGAQVFGKAFDHPKSLIMEYLDLLGSAMEVCGI
EFHPNHPSILYVFNSSTQVYAFDVVSERRLAIYAAPGHSFGGNMSMSLDGTMIATLGQTN
NVLLWNPASKPAPLGAAGRVETIALHPTGDAVAACHSCAEKTRVMDVKNPSMLVYEFVNT
KNTSTACTRVVYNKGAGGDEGRYVAATTNTGAICVGEVHNDQVTTTFFDTFKYDSIDVAL
HPSGQFVAALGLDDQYHGHLRYIRRDDGTVVWEMAGMAKEAVRMGGMALQMSRTGDLVAC
LASLDQLSVFDTAAGTMAFSIRVQGGVRCYRFTPSFDMVALCAGRGNLQVWRRDALESPV
ITLKPPHTDATNITGIAVLPDLNIVFSCAEDGHLIATSLTDGAVLGVYANAELQPIHGFD
ILPSRVPRLAFGDDLGRIVVLDWKGAT

Enzyme Prediction     

No EC number prediction in H310_11320-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	183	300	4.9e-21	0.9193548387096774

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395611	F5_F8_type_C	2.19e-19	181	298	2	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
225201	WD40	3.35e-10	1383	1704	160	458	WD40 repeat [General function prediction only].
293791	7WD40	4.50e-09	1669	1952	9	288	WD40 repeats in seven bladed beta propellers. The WD40 repeat is found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing, and cytoskeleton assembly. It typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40. Between the GH and WD dipeptides lies a conserved core. It forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel beta-sheet. The WD40 sequence repeat originally described in literature forms the first three strands of one blade and the last strand in the next blade. The C-terminal WD40 repeat completes the blade structure of the N-terminal WD40 repeat to create the closed ring propeller-structure. The residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands, allowing them to bind either stably or reversibly.
404200	DUF4062	2.09e-08	499	585	2	68	Domain of unknown function (DUF4062). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 80 amino acids in length. There is a conserved SST sequence motif.
225201	WD40	7.31e-08	1606	1954	57	436	WD40 repeat [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNA76275.1|CBM32	6.47e-24	175	317	53	190
SLM01661.1|CBM32	8.07e-24	175	308	37	166
AEV85855.1|CBM32	8.07e-24	175	308	37	166
ATO84251.1|CBM32	8.07e-24	175	308	37	166
AGL19776.1|CBM32	1.89e-23	175	304	36	160

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RV9_A	3.35e-21	174	303	7	136	Solution structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZXE_A	3.45e-21	174	303	8	137	X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_B X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis],4ZXE_C X-ray crystal structure of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5. [Paenibacillus fukuinensis]
4ZY9_A	6.41e-21	174	303	8	137	X-ray crystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZY9_B X-ray crystal structure of selenomethionine-labelled V110M mutant of chitosan-binding module 1 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
2RVA_A	6.71e-19	174	303	7	137	Solution structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]
4ZZ5_A	6.90e-19	174	303	8	138	X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ5_B X-ray crystal structure of chitosan-binding module 2 derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_A X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis],4ZZ8_B X-ray crystal structure of chitosan-binding module 2 in complex with chitotriose derived from chitosanase/glucanase from Paenibacillus sp. IK-5 [Paenibacillus fukuinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q149M9|NWD1_HUMAN	3.78e-74	531	1285	23	771	NACHT domain- and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=NWD1 PE=1 SV=3
sp|A6H603|NWD1_MOUSE	1.78e-72	510	1254	3	739	NACHT domain- and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Nwd1 PE=2 SV=2
sp|Q6P5U7|NWD2_MOUSE	1.38e-67	473	1197	15	763	NACHT and WD repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nwd2 PE=1 SV=2
sp|Q9ULI1|NWD2_HUMAN	7.10e-67	473	1197	15	763	NACHT and WD repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NWD2 PE=2 SV=3
sp|O08653|TEP1_RAT	4.17e-17	497	1116	912	1449	Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000001

TMHMM  Annotations     

There is no transmembrane helices in H310_11320-t26_1-p1.