CAZyme Information: H310_11285-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11285-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1194		132541.55	7.5718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913981:547317-551399(+)

Full Sequence      

MGRHVAWVSMLGIQKMAMLAIAAHALMNGSGLLSGAVEEFRVSRGMIDFRGDIGQIGRTT
STIKQQSQRSSYIVSMKSMHRFCKDLSEALDHDTAERCWVTLFDTFPNVDRSPMAFQVHY
DYARHIENGSNDRTSAAKTAYERALAVMTEPSSPLSLDAMNRLGLLWQKLSRPHVAIEVF
RQSLQWHPHECALRGNLASAYLELGNVAAALAAAAVALKLEPHNAALHHNMGNIYQRAGD
MLSAMSHWQKAVEIDPQNPNPLFSLGIAAGNQGLSDTSTAYFAKSVVVASQHAPALRDLA
RLQLATALLPRVYDSTNDIHQIRQTFTTALEDLMADSPLSLGDNPIYTTGCGSMGYYLVY
QGGPNKHLRRTLAQIYEKSMPGLEFEAPHVRAARHHTFQFPSTARFVDARPSNVSAAVIV
HRRIRVGILSAFMYHHSVGLLMQGVLTRLSNATYELVLLRCRPWHADHVTDRVSRHMSRV
VQLPNDVFHAQQVVADLALDILLFTELGMDASSYFLAFATLALRSVLFWGHAVTSGLSTV
DYFVTSTHFQSNPVSGSSDEFTETLYPMQSLTTVFHRPRFSFHRSLLSFLPADDDGRVMY
LIPQTLYKLHPAMDSLVAAILAGHRNSYLVLLEGAVPHLATQIRRRLGRVLSLQDLESRV
VFAPYLSTDAFLTLCQVADVVLDPFPVGGGRSSFEVFSVGTPIVAHTARTSIAQLTAAMY
TKMNITACCVAATDEAYETLDSSVATALALGQNTSYRQEMSTLIQSRSSVLFESDASTVA
SVMDDWNRCFHTILAMPPPPRPTPASTVAIPFGFRLQLFGQLSVEVVMHANETPTQVGAT
IAALYGLEPLYQCYIQTLLFHGVQRWRQNEAQLAITTDAFPGRTPPLDIYVGDDVALAVQ
YHLWRYNHRVPGRDVAVAVASIRHKLAFSDASAPWIAARGVQHRPPRSAVQAHDAPLQST
RQCLTVALTTCKRLSLFLATMKSFLPYANSTAVAICMILVLDDHSSAADRRVMQESFPTV
QFVFTRRKGHAHSLNLLLDLVSTPFVLYLEDDWQWLQDLPHHPIAHALAVLDSDPTLVQV
LLNTQFSGWPRTMHDSHPFDVYFRHEFGIVDHAFGYWPGFSLNPGVWNLRRLRQCPRLTF
NERSDVFEREFSLAVWQCGLHVAMLPYTTAVHIGAAPGTNGSAYALNGMPRRFD

Enzyme Prediction     

No EC number prediction in H310_11285-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	129	772	2.1e-67	0.6226950354609929

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.15e-26	135	776	1	602	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
276809	TPR	6.30e-12	158	253	2	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	9.83e-11	137	307	375	547	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	3.70e-10	196	284	6	94	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.66e-09	225	305	1	81	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBO34148.1|GT41	1.02e-52	304	776	516	938
QGJ68883.1|GT41	1.31e-50	304	788	280	720
BAP54338.1|GT41	1.77e-49	301	773	138	570
BBO66743.1|GT41	4.88e-47	308	773	463	886
ACB77232.1|GT41	5.67e-47	309	740	348	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	1.05e-06	421	704	160	436	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]

Swiss-Prot Hits     

H310_11285-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.910466	0.089543

TMHMM  Annotations     

Start	End
5	27