CAZyme Information: H310_11219-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11219-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	KI913981|CGC1	40893.72	6.3082

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913981:281800-282885(-)

Full Sequence      

MAQTSTENSVPSGMADRPAELDPMLAVSLPSSPGVGRQINIKYVATIVILVIIVLNVLFL
DSFAVVLSQGKSHVSPIGLEAQLANTTLLVDSHGNRLRLAYMLYATDARTVCNAIILASN
IRKLGTPASIPIVTLVGNDVPPSVIQRLTDANIVAIPIDPWKQERVDQSDEWFRSLTKLR
IFEERGYDKVIYLDSDVWVHRNLDHLFFLGDAVLWAPHAYYIKENYVFGSTLLVFTPSNA
VFHEIQDAMAHPPRPNYFDMDVLNDLYKLHCGFLPNNYVVLTYTLHDNANWSFASKADRI
HKTYVHHFSPDGTFGKPWNMARSEVYNRRGSIDSVFYNLYTMYWEHEDCLCAWLKQDKSD
P

Enzyme Prediction     

No EC number prediction in H310_11219-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	98	319	1.9e-27	0.8793774319066148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	6.45e-37	100	328	2	249	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	3.60e-25	111	344	13	233	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.69e-09	41	209	7	190	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
133037	GT8_A4GalT_like	7.97e-09	187	319	96	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
215090	PLN00176	2.44e-08	177	325	103	280	galactinol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55795.1|GT8	6.41e-79	98	352	119	370
ATZ54055.1|GT8	7.78e-19	87	328	6	268
CCD34263.1|GT8	7.78e-19	87	328	6	268
QRW19876.1|GT8	2.06e-18	98	325	57	297
APA10338.1|GT8	3.45e-18	98	328	65	316

PDB Hits     

H310_11219-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4HVS2|GNT1_GIBZE	1.35e-13	98	282	154	350	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q4WBL2|GNT1_ASPFU	2.00e-12	98	325	79	333	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q947G8|GOLS1_SOLLC	8.54e-11	131	343	51	278	Galactinol synthase 1 OS=Solanum lycopersicum OX=4081 GN=GOLS1 PE=2 SV=1
sp|Q9XGN3|GOLS2_AJURE	1.44e-08	117	332	3	241	Galactinol synthase 2 (Fragment) OS=Ajuga reptans OX=38596 GN=GOLS2 PE=1 SV=1
sp|Q9Y761|GNT1A_KLULA	1.93e-08	100	221	97	224	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999985	0.000034

TMHMM  Annotations     

Start	End
43	65