CAZyme Information: H310_11188-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_11188-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		27192.04	4.8693

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913981:159257-160035(+)

Full Sequence      

MNVLMASLVVVMCLMVYMNVFMLGMNQDESNSAHLKKLSQNFRKAEAVEAANNPNKDPLN
RRIVVLIANYRDSKRCGETVESIYSKASRPDLISVSIFDQLNFEEGEQRCFDVYCTLVGE
KECRRSERLRRNDTISYKDAKGPTYGRYQTEEGVDLKVDTFAMAIDSHLIFIPNWDTDLV
SQWDSIKNPKAIITVYPDTTELYPKPGDVQQVVTMMCHARIESDTDDAMVQIQLWYC

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	63	224	1.8e-27	0.5272727272727272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	3.23e-18	63	224	2	191	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22347.1|GT60	6.00e-46	61	235	58	227
CCA18910.1|GT60	1.17e-44	61	231	85	249
QVE55543.1|GT60	2.17e-18	54	196	60	199
UIZ22573.1|GT60	2.13e-14	54	196	63	205
UIZ25301.1|GT60	2.76e-14	58	196	45	183

PDB Hits     

H310_11188-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	3.87e-08	63	197	6	144	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999953	0.000080

TMHMM  Annotations     

Start	End
3	25