CAZyme Information: H310_10877-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_10877-t26_1-p1
• CAZy Family: GT24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449		48498.78	6.9455

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913979:396498-397955(+)

Full Sequence      

MASKNIVFVSVGTRGDVQPLCIVGQALAAQGHTVSVASDRRLESLITHEFGLAFRPLEGD
FCGLLFHDDFHDRFRKANVVQLIGLMEEWSSRSDKAAVLASYVPALQGADIIVSGPLCAD
ESYAVAESLNATWVPLFFGGFNLPTTAYPHGMMQAFVGSWFGAVNKWTHYFIWSKLWGGK
RDHINAWRTQQLKLAPVTSAYGVLDALLTNDSIVQLQACSLLFSGPQHEIPTDYAPGKVA
YAGFVFPIMAQPEPEPLKAFLVANSTPVIYIGFGSMPTLKPRELLQFAIDVSKIAGCRAV
LAAGWSSLDQESSKDLADAHADTVYIETGSISHTWLFPQMSCLVHHAGLGTIGAALRSGI
PQLPCPVGIDQFYNASVLVQLGVAPCTVSKKQFVSAKYVGSAVHKVLRNDKDIQGKARDL
GLFVSKESADAVPRLCALILDAKPTFSTA

Enzyme Prediction     

No EC number prediction in H310_10877-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	221	421	1.9e-28	0.4083769633507853

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.59e-38	5	441	2	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	8.73e-20	3	410	1	369	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	2.02e-08	236	411	264	434	ecdysteroid UDP-glucosyltransferase; Provisional
397255	Glyco_transf_28	3.26e-08	6	60	1	56	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
215465	PLN02863	1.09e-05	268	386	285	411	UDP-glucoronosyl/UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFZ92053.1|GT1	2.26e-45	5	441	2	404
UBF30661.1|GT1	6.86e-44	2	439	16	431
AZB72360.1|GT1	1.67e-43	5	441	2	404
BAS59239.1|GT1	8.13e-43	5	439	3	415
BAS65587.1|GT1	8.13e-43	5	439	3	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.06e-28	10	427	26	425	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.66e-28	10	427	46	445	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A950|ATG26_CANAL	1.33e-38	3	418	1014	1411	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|A7KAK6|ATG26_PICAN	1.49e-36	1	428	785	1190	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1
sp|Q6BN88|ATG26_DEBHA	7.83e-35	3	382	1047	1415	Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ATG26 PE=3 SV=2
sp|Q9Y751|ATG26_KOMPG	1.41e-33	5	436	762	1173	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|A1CFB3|ATG26_ASPCL	8.84e-33	3	419	907	1310	Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=atg26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000002

TMHMM  Annotations     

There is no transmembrane helices in H310_10877-t26_1-p1.