CAZyme Information: H310_09986-t26_3-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_09986-t26_3-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40898.19	6.0015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913974:842604-843821(+)

Full Sequence      

MMTWNALVLTALAVHGTGVQASDSNPCAMDFERSNAALNLIHVCSLNTTQPRILCFVNTI
SPNHDTKARTIKETWGKRCDKLVFMSNVTDDALGAVAIDHVPSDHNHLWQKHKASIEYIW
DRYRHEFEWFYKADDDAYVIMENLRAYLRSPEIVMQQDVVPLQLGHRFRLTDDLIEYYVG
DRLLLDAYQQRWPHWWVFNSGGPGVAMNSLFMQLAVQLFPQWTCLRDEHSQMLPDDAAIA
FCMAWYDVFPPNTRDLRGRERWHANHPHGVYFTDPSEYPDDIWFNQYHRGIGGIQWKDDC
CAPDSIAFHYVSPDYMLHIERQLYTCRASGATSLRQASMPVGDHGPIAQDVVFS

Enzyme Prediction     

EC	2.4.1.122:25

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	0.005	48	242	1	186	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55842.1|GT31	1.19e-141	6	337	9	316
AIG56262.1|GT31	4.35e-138	4	329	5	328
CCA14287.1|GT31	1.52e-105	27	327	31	338
UIZ22190.1|GT31	7.45e-105	83	352	1	282
UIZ24342.1|GT31	1.73e-54	37	316	37	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	1.04e-38	49	330	25	273	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7K237|C1GLT_DROME	2.42e-37	49	330	97	345	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q18515|C1GLT_CAEEL	1.25e-31	52	330	105	350	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2
sp|Q5F3G7|C1GLT_CHICK	2.11e-28	52	330	89	331	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q0VC84|C1GLT_BOVIN	2.88e-27	52	340	88	340	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ06|C1GLT_MOUSE	4.82e-26	52	340	88	340	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000200	0.999787	CS pos: 21-22. Pr: 0.9691

TMHMM  Annotations     

There is no transmembrane helices in H310_09986-t26_3-p1.