CAZyme Information: H310_09456-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_09456-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759		85869.95	6.3251

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913972:528548-532224(+)

Full Sequence      

MLPPQVKLEAFQFYGFECHGLFAQEDLPADTTVWIWDTVTEPLVTFTRKEVMDHPERQKL
INFSYMVNDDCFASTTTPEDDPCWYFNHSCDPNCWFEGDGKIVTRRPVKKGEQLCYDYAC
TETESSLHVNMNCRCGAEKCRGQLKFSEWRSRGFIKKNLGHVTEYIMRKHAENGWYDTRM
ELRYKSKSSMGLFCREESDCKILKGDIVLMFSGKIVHKDTLLESGAMTPRDFEMSLQVQR
DLWQIPAWKETGDKCETSDYINHSCDPSCGMLDSVTVVAIRDLYPGEEITIDYCMVNDGT
NSDPSDNFTCMCGSVNCRTTITTLDWQIPELQTRLGQYFAPFVKQLSKEAASDESHSSLG
FVMSDVSSSFSITLVGVVWIHGASVGECLSALPLIKEITQDNKETSTTEPCQVLFTTTTP
SARALLTQRLHSNPNAHCIFAPLDHAPCVRRFLDTWRPVAAIWIESELWPNLIVETGSRQ
IPMAILNGRMSFRSFRRWDSWIGRRLVRSMLDHFQLVLCQSSQDESRYLHLGHAGAKYVG
DLKFLAEKHAIDATSLIELKESVESRAVWVAGSTHEGEEEVVLQTHEALKAQHRRLLLVL
IPRHPHRVESILALISTQHPQLKVTWRSQHRVPAADSDVFIVDSMGETQLCYEVARVAFI
GGSLVPVGGHNILEPLRSGCPVLHGPHMFNFTSVVQSLASPQVVLVTASTLATTLDAFLS
APQRTLVAVAPPTLERIQRDIWTRVHRFLDTAQAYKKEV

Enzyme Prediction     

No EC number prediction in H310_09456-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	376	545	2.6e-48	0.9096045197740112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235589	PRK05749	4.21e-114	376	724	51	391	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
224436	KdtA	9.21e-111	376	724	50	389	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
398219	Glycos_transf_N	2.69e-57	376	544	14	174	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
395687	SET	2.88e-14	20	118	3	114	SET domain. SET domains are protein lysine methyltransferase enzymes. SET domains appear to be protein-protein interaction domains. It has been demonstrated that SET domains mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). A subset of SET domains have been called PR domains. These domains are divergent in sequence from other SET domains, but also appear to mediate protein-protein interaction. The SET domain consists of two regions known as SET-N and SET-C. SET-C forms an unusual and conserved knot-like structure of probably functional importance. Additionally to SET-N and SET-C, an insert region (SET-I) and flanking regions of high structural variability form part of the overall structure.
380929	SET_SETD2-like	1.19e-13	190	318	12	136	SET domain (including post-SET domain) found in SET domain-containing protein 2 (SETD2), nuclear SETD2 (NSD2), ASH1-like protein (ASH1L) and similar proteins. This family includes SET domain-containing protein 2 (SETD2), nuclear SETD2 (NSD2) and ASH1-like protein (ASH1L), which function as histone-lysine N-methyltransferases. SETD2 specifically trimethylates 'Lys-36' of histone H3 (H3K36me3) using demethylated 'Lys-36' (H3K36me2) as substrate. NSD2 shows histone H3 'Lys-27' (H3K27me) methyltransferase activity. ASH1L specifically methylates 'Lys-36' of histone H3 (H3K36me). The family also includes Arabidopsis thaliana ASH1-related protein 3 (ASHR3) and similar proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUS41283.1|GT30	2.35e-71	378	698	69	373
BDG75271.1|GT30	2.95e-71	378	700	59	371
UKV15292.1|GT30	3.08e-70	378	698	53	361
UEM22691.1|GT30	4.17e-70	379	705	53	367
AJD50742.1|GT30	1.61e-69	378	698	53	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	9.27e-32	376	687	41	310	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]
4BFC_A	8.95e-22	563	738	39	217	Chain A, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]
5F59_A	2.62e-10	20	141	28	151	The crystal structure of MLL3 SET domain [Homo sapiens]
5F6K_C	2.91e-10	20	141	32	155	Crystal structure of the MLL3-Ash2L-RbBP5 complex [Homo sapiens],5F6K_E Crystal structure of the MLL3-Ash2L-RbBP5 complex [Homo sapiens]
6KIW_K	6.96e-10	20	141	78	201	Cryo-EM structure of human MLL3-ubNCP complex (4.0 angstrom) [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	1.70e-53	378	707	57	383	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|P44806|KDTA_HAEIN	2.79e-53	378	710	53	376	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
sp|P0AC75|KDTA_ECOLI	2.50e-52	376	720	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
sp|P0AC76|KDTA_ECOL6	2.50e-52	376	720	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
sp|P0AC77|KDTA_ECO57	2.50e-52	376	720	49	386	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000000

TMHMM  Annotations     

There is no transmembrane helices in H310_09456-t26_1-p1.