CAZyme Information: H310_09158-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_09158-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47184.38	8.6116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913971:240211-241921(+)

Full Sequence      

MQARTAGVFAVGLIVRLACVIWAEYQDRTMPVKYTDVDYDVYTDASREIVQGNSPFDRTT
YRYTPILAFMLLPNVHVHEAWGKLLFVASDIVVGYLLYAILRLRAMPESSAINYTMWWLF
HPFSINISTRGNADTVVVLMCLLTIYFLMRKHLVVAAIFYGLAVHFKIYPIVFALSFLVF
LDEDYDASIRPLKTTAGGFAKAWHWLNRRRLAFGVISGGVFLGLTAGFYFMYGYTFLFEA
YLYHLTRTDNRHNFSMYFYDLYLRYGTNIGFVMGLLAFLPQFLTLFNISLRCGKDLIFAQ
FLLTITFVVFNKVCTAQYFLWYSVYLPLVLPTSELNGWQGLGIIGAWFGGELHWLYWAYG
LEMLGHNTFFPIWVAGLVFFAVNIGIMALFISKHHLHPLFSNGSVVALAKD

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	127	390	1.4e-89	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	9.54e-134	14	411	17	435	GPI mannosyltransferase
252941	Mannosyl_trans	1.94e-72	127	391	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
401508	GT87	0.008	63	179	3	122	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	5.77e-159	8	405	8	407
AAP59446.1|GT50	2.92e-112	1	400	1	419
ANM71067.1|GT50	2.92e-112	1	400	1	419
AED92986.1|GT50	4.68e-112	1	400	16	434
ABH04628.1|GT50	4.68e-112	1	400	16	434

PDB Hits     

H310_09158-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54IA4|PIGM_DICDI	7.49e-120	5	395	25	431	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q500W7|PIGM_ARATH	8.31e-113	1	400	16	434	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	4.17e-109	1	399	14	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	4.17e-109	1	399	14	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	4.17e-109	1	399	14	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.836693	0.163321

TMHMM  Annotations     

Start	End
159	181
211	233
269	291
298	320
335	357
369	391
7	26
84	106
127	149