CAZyme Information: H310_08950-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_08950-t26_2-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein, variant 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383		42772.79	9.9855

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913970:371811-373275(+)

Full Sequence      

MTVAQVAAAAIVSRGWVSLMAMFSHAFITPYDTSAIAHSKSIFSAFAAWDGVYFVGIADQ
GYRYENTHAFFPLFPLLVRWTSPLMLPFLDKNASLLAAGWLISNASFVVAAVFLYLLGLE
VLKTESVAKRAALLFCICPSGIFMSACYSESLMCALTFSGMYLLERSRTARRASGPMFLI
FSALLFGLSSATRSNGILHSLYIAYYQVLASPHPVRAFPQFVAHWTFTASLGAIAIGFQV
AYFLHGIAAYCASYASAMQVVRSVFHIAPSALAADRPWCSQVVPNFTAMYMFIQREYWGV
APFAYYELKQVRRQHSTDPLAIPSSRHRSQTSSWRRPCLLWQVTPATSGASSARRPRSSR
RDRILFTWHFSWSMCWLLSIFKS

Enzyme Prediction     

No EC number prediction in H310_08950-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	9	311	8.6e-67	0.6977886977886978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.71e-28	49	311	60	300	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.07e-08	39	205	64	217	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	3.98e-82	10	311	13	308
CCA18790.1|GT76	4.90e-59	10	311	13	374
BBN03197.1|GT76	4.64e-36	49	366	84	378
QHO38400.1|GT76	2.63e-33	49	311	81	322
QHO07244.1|GT76	5.04e-33	49	311	81	322

PDB Hits     

H310_08950-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TPN3|PIGV_MOUSE	3.05e-27	40	322	57	336	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q5KR61|PIGV_RAT	4.13e-27	40	322	57	336	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q9NUD9|PIGV_HUMAN	9.18e-26	40	322	57	336	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q2GSI6|GPI18_CHAGB	1.04e-18	41	308	73	351	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q290J8|PIGV_DROPS	1.48e-16	49	311	66	327	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.966270	0.033730

TMHMM  Annotations     

Start	End
7	29
96	118
131	153
222	244
364	381