CAZyme Information: H310_08656-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_08656-t26_1-p1
• CAZy Family: GT105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102		123266.68	7.3550

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913969:334027-338288(-)

Full Sequence      

MSSFPVLVDAHLLRVITSFQDGVFVELLPLYAAWKSLAQRPSSLSTVAMQPTDLSLATVA
DSRYVLHAVVACHDVSYVDRVLQCCRQEMITPELIDCAARHGHLDLVQQFHFRGFPWTSR
AMDLAATYGHLHVLEFLHAHSDDGWTEKAMIGAAEAGHLAVVQFLHTTRPEIPSSFRAMD
YAARNGHYNVVRYLHFHRPEGGSAVAMDFAASHGHLEIVQFLHTHRQEGCSTYAMDGAMR
NGHHDVVRFLHTHRTEGCSRKALMYAMQHELHDMIPILRSYHGTMRAMSSAAVARARAKF
SLGRPLARRRYFLASIAFGHVLKKTTMVTTQEESTPLLPTATEKRKLQDRRHRQFMCFGG
IATLAACVTGVWWWTSLTIPAVFIADVPLAPWTSDVMEPPFIKETNLIRPKLIAEDLLKR
PVPTNAWWTNLLISDSHGQNTGAGQVTLSPYTIASWPHVMQVSYGDDRRVEEPSKIEEYF
SADLTFGTVVPSVSRQIVAFDPLTVHLQYRNESNGTTFTVLLARGSPYISINYTLSAPVI
TTTYFNMLRCNNQTLSSKTPTTLFGTMFTLITQMERQKTQEWLLFFPKNVTVSVNSTSFA
VQDETFSGIVRAAIVPRSNPEGTAALLRQHASIVPVASAVTLSSNDTTGIMEFTWKTAAT
TNDSIAGASLLMLAHPHHVDSLVSGRNRSLTTTVMHSSTSGGPFASSTPSTLLGQFGHRT
IKGNMSLVVGNSWRLADTFQEVGFHSQRPIATEAIMPLLVALKNDSNYTPHALDPYFFGK
EVARQARLVLIADELNQGTTKLLDQLEDLLLPWFVGKNIDYFVYDTVWGGVCSVKGLRGV
FWMTDFGNGWYNDHHFHYGYFIYAAAVVAKYRPAFVLRHRAVLMSIVRDIANNSPHDPYF
PLARHMSWFDGHSFASGVYVLDGGKSQESVSEAINAYYAVYLLGQALEMPMVEKMGRHLM
TLEMRAATTYWQTTEEIYGSVYAQNQMTGQIGSTKVTYATWFGPEVEHMHLINLMPFTPV
TELFVSPAFVNREYPILEKALNRTKTPMDEIWKGYTYLDHAIIDAKAAWDEVASLGTFDD
GNSRVNSLYWIATRPLANSTPT

Enzyme Prediction     

No EC number prediction in H310_08656-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	411	1090	2.4e-145	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.58e-78	776	1084	32	345	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.32e-76	410	1084	78	745	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.89e-27	421	741	14	307	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
403870	Ank_2	4.59e-08	124	194	3	80	Ankyrin repeats (3 copies).
403870	Ank_2	5.97e-08	153	222	4	80	Ankyrin repeats (3 copies).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	2.74e-184	399	1094	71	815
UIZ24045.1|GH81	5.83e-116	397	892	74	606
AGP40408.1|GH81	1.16e-105	397	1095	56	702
CAN97272.1|GH81	9.02e-105	387	1095	56	718
UQA58532.1|CBM6|GH81	3.58e-103	421	1095	300	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.29e-52	422	1095	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.59e-52	422	1095	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.55e-50	422	1095	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.76e-36	718	1091	281	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.55e-24	705	1085	291	675	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	8.10e-47	582	1092	237	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	7.75e-42	421	1101	34	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.88e-41	580	1092	390	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.58e-37	644	1099	664	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.19e-36	581	1092	626	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000001

TMHMM  Annotations     

There is no transmembrane helices in H310_08656-t26_1-p1.