CAZyme Information: H310_08619-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_08619-t26_2-p1
• CAZy Family: GT105
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399		43606.83	6.2791

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913969:165210-166793(+)

Full Sequence      

MRAASVVLALRVLFPLARVAADNEAPGAVLQWYAPFLSGGGYCSEAISFAGALAQINSPL
FSLHITQHGDSVNPTFSKSLPTKTQELFKSHWFTPPTASPPTIAICHSEPGAWNPPRYQT
TLCPPKGTEYAIGRTMFETDRLPSGWAERMNDIMDEIWVPTTFAKTIFEAAGVPASKVTV
VPEAVDVAFFNPDNVAPLPIDGVSSTTTVFLSIFKWEERKGWKTLLKAYFAEFSRTDDDV
VLVLLTNAYHSSSDFASLVERFALDTFAGRSLEELPRIHILPPHLAQEDLPALYKAATAF
VLPSRGEGWGRPHVEAMAMSLPVIATFWSGPTEYMTQENSYPLDIEGLVPVMPPSSWMMA
KLDHTVGFVGRVGGIQRTSLGRAIRHTPSATHAACRPSS

Enzyme Prediction     

No EC number prediction in H310_08619-t26_2-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	207	339	3.8e-18	0.74375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	8.06e-24	169	336	157	307	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340828	GT4_WlbH-like	7.65e-23	154	340	142	320	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
223515	RfaB	1.68e-20	146	349	143	333	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340838	GT4_MtfB-like	9.45e-20	157	326	142	299	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
404563	Glyco_trans_1_4	9.65e-16	216	349	11	129	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26988.1|GT4	7.09e-121	22	351	150	524
CAB4085108.1|GT4	1.16e-95	23	351	81	420
VDC77730.1|GT4	8.18e-94	22	351	69	410
CAG7890560.1|GT4	8.18e-94	22	351	69	410
BAF24714.1|GT4	1.41e-93	22	351	72	420

PDB Hits     

H310_08619-t26_2-p1 has no PDB hit.

Swiss-Prot Hits     

H310_08619-t26_2-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999693	CS pos: 21-22. Pr: 0.9455

TMHMM  Annotations     

There is no transmembrane helices in H310_08619-t26_2-p1.