CAZyme Information: H310_07018-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_07018-t26_1-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
966		108512.86	6.4020

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913964:110742-113794(+)

Full Sequence      

MLALASFVCTTLLGQALGMPNPKANPAAVVLAGHARFTVLTSQLIRLEWSSVASEFRDVA
TVVVNNRALPVPTYQVTTKGEWVEITTDTVHLRYDTSSTVSFSDANLRVEVSSVSSKNNT
VTWTPSLTDKDDKRLFGSLRTLDMTNGTVNLDCNAGGPDTIADSHCTYGLISRSGYVVVD
DSLSSELNNDPWPWVVEKTPTPAAGCAAIPAHERRVCGYNIVTQDQCDANGCCFDNSASL
PNGFMCYYGTKAYQDLYFFGHGLQYKQALKDFTRIAGAIPLPPKYALGVFYSRWWAYNDV
DIDEIASEYHTRSIPLDVIVLDMDWHLTFYKNNSADQSGQPKGWTGYTWNNELFPDPNAF
LTHLHDLGLYVTVNLHPASGVQPWEDSYDAMARAMGVDPATKHYIPFDLTNKTFTTNWLT
LSLKPREDEGVDFWWLDWQQGEDWFVAHQQASPNLNPTLWLNHVFFTNPFHWTEKRPVLL
HRFGGLGNHRYPLGFSGDVVPSWDSLKFQPYFTSMAANVGFTYWSHDIGGFQQGHNAELF
TRWIQWGVFSPVLRTHSQKDRVSDRRIWTYPTTHYEIMRLYMNLRRQLVPYMYTQSRITH
ETGLGLLHGLYYEWPELDEAYSFSHQYVFGSAFIVAPILTPVDAKTQLAHQTVWVPPGVW
FDMTLGSLIQGPTEYSHAYALNEVPWFAKAGSIVPFGPRSTRTSLGQAQTSPTALTLTII
PGASRGSGSLYDDAGNSNAYLNGEHTWTHFTYQAHGDSDAQVTIHPVNGTFDGGHRPTRR
QHYVVEFRHAAPAHTVQVNGQDVKFVSFGDTAHLGWTYEANRLTVRVHLDADIAATTTVK
VEFATSSGPKVSWNGVVGGIARLQQVKTLLDLQFAYAEDYPYLRHAYGMSRRIQYNLASF
FHEVALWPQWIKLAVGEVAKLKIDPKVQAQILHLLEDSVGHTTHHGPPLRSIDFDDVVVA
DAFIFN

Enzyme Prediction     

No EC number prediction in H310_07018-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	257	694	1.3e-107	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269881	GH31_u1	8.36e-158	276	591	1	303	glycosyl hydrolase family 31 (GH31); uncharacterized subgroup. This family represents an uncharacterized GH31 enzyme subgroup found in bacteria and eukaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
395838	Glyco_hydro_31	6.95e-103	257	694	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
224418	YicI	1.45e-97	257	804	236	771	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269876	GH31	1.06e-55	277	581	1	264	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
269877	GH31_xylosidase_XylS	7.39e-43	277	585	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55715.1|GH31	0.0	21	935	19	899
ABF40957.1|GH31	1.09e-211	21	921	42	879
QNI33042.1|GH31	2.57e-208	21	941	35	893
UJR32215.1|GH31	4.15e-198	24	630	23	625
BBC80767.1|GH31	3.45e-192	22	863	34	804

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7WJ9_A	1.82e-125	35	748	40	660	Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_B Chain B, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_C Chain C, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_D Chain D, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_E Chain E, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJ9_F Chain F, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJA_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJB_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_B Chain B, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_C Chain C, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_D Chain D, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_E Chain E, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WLG_F Chain F, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363]
7WJC_A	2.68e-124	35	748	40	660	Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJD_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJE_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363],7WJF_A Chain A, Alpha-xylosidase [Lactococcus lactis subsp. cremoris MG1363]
7KMP_A	5.95e-41	257	744	408	910	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
4B9Y_A	7.52e-41	234	703	205	681	Crystal Structure of Apo Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31 [Cellvibrio japonicus],4B9Z_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with Acarbose [Cellvibrio japonicus],4BA0_A Crystal Structure of Agd31B, alpha-transglucosylase, complexed with 5F-alpha-GlcF [Cellvibrio japonicus]
5I23_A	8.27e-41	234	703	182	658	Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF022 [Cellvibrio japonicus Ueda107],5I24_A Crystal Structure of Agd31B, alpha-transglucosylase in Glycoside Hydrolase Family 31, in complex with Cyclophellitol Aziridine probe CF021 [Cellvibrio japonicus Ueda107],5NPB_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with alpha Cyclophellitol Cyclosulfate probe ME647 [Cellvibrio japonicus],5NPE_A Crystal Structure of cjAgd31B (alpha-transglucosylase from Glycoside Hydrolase Family 31) in complex with beta Cyclophellitol Aziridine probe KY358 [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P999|XYLS_SACS2	5.18e-43	257	745	192	668	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|B3PEE6|OL4AG_CELJU	3.85e-40	234	703	205	681	Oligosaccharide 4-alpha-D-glucosyltransferase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=agd31B PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	4.35e-40	229	802	199	770	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|B9F676|GLU2A_ORYSJ	3.72e-30	258	752	333	833	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q4R4N7|GANAB_MACFA	3.53e-29	262	740	369	854	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999631	CS pos: 18-19. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in H310_07018-t26_1-p1.