CAZyme Information: H310_06945-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_06945-t26_2-p1
• CAZy Family: GH6
• CAZyme Description: hypothetical protein, variant 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1471		164597.08	5.9847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913963:1264782-1270174(+)

Full Sequence      

MLAARMWMGLAALAASSRMADGRQVHVNLTTSYLASPLYPILETSEFLSQDDPALFFKYL
SAVNMRHNAIKDKHDVNYTKVALEAAADVLPEDSSVSRLLPFVLQTRAHSPSIELFHQLA
IESAFKGCPNETVSAWAIIYRSAGCADAVMCDVEDFDSSVLDAAAPALDDSERTCAASGQ
HDFYLPVDHVYPSTASVAANAPHVVVYGELTSPSFQAFHSKLLPLAVAGSIKYIVRHAPT
NNTLPVLVHGYGVTLHVKNMEYKTFDDSKTSKSSSNGTSVDIDDDQDDFVVSVMMKKHDE
VAQALRNYLEDFDDASAVDEFASDDVDDAKKKAPWQLTQLGYLAMQYIMASADPLKRLQL
LSQNFPKYASSLVLTSKPVAAETIEAMGLVRNQVISQRLHNRIVVNGLPVDFNEYGFNAF
DFLKSLSGELRLADTLAKLDPSGTIRGAVGSLSSAPADVRITLRGPVDGFAPLYLNSIET
DEETEDWPTDMGILRAPTWNLIYLRKVMYELILVVDPTTKEGIEALNEVNFLRNRQAPIQ
FGVLWTSPQLLALSAEERAAYTPSVRDEDLATVFHVAKMFHAAKKHSKAARDKYLREVVS
VNDLKVKEVLQMYSQAVGERFSNDAWLEDAKAILTDGDNDPVWAMTDLVAAKKLPINSHV
FNGVVRNHVHVQEDIMSHFGRDQSLYQELVRGDKITDDADMLNELVGSEESYAVYCPWFD
PRYQAPRTVPEFSWDEPAWKQVGSFHAAGTASKPKRQNVLLLANLDTATGAQSAYQALKR
VPDYPDLGLTIVHTGASSNTLGHRVSYMLSQLGHTDSTTYMAVVLEVLRLMSKKPEADVL
THARLFLQLHLDAAPNDKILTKLNEWLTSTPSFSHPFSFKVDPHNHVIYVNGRPLDLAAS
PLSAEHFDVLVVHEASTRSKAVSKAYVAQFKHDNLSVEDAADKSLAFNLVMNAIDEYLKV
RRVPSVLPEVNPLYSYETPTSQPSGLDVVAYLDPLSETAQRASGILRMLASVLHAKITLV
LLPSPSYEEFPLKRFYRFLWGGSESSSVDFLRLPRKPVLTLNIEPPELWNVQMIQSDVDV
DNIQDDASATFYIKDVLVYGQCVDRTIVHYPSLPNGLQLTLERSAGTVHSHKDTVVMKNL
GYFQLQAAPGVWELGLAKGRHSKLYELVIQEDRATTVPVIVYDFLSSTLQLVVKKQHGQE
SVRLLDEDEPAHKTTGEAVEEKSYWRSLVQWGSDPPSSKRDARSGDTIHVFSLATGHLYE
RMLKLMMLSVMKRTKNPVTFWLLENFLSPDFKNSVGALQAEFGMDIRFITYKWPNWLRRQ
TEKQRIIWGYKILFLDVLFPLGVEKIIYVDADQVVRADLNELWTMDLQGRPYGYTPFCDS
RNVGFQFWRTGYWKDHLRGKPYHISALYVVDLVKFKRMAAGDSLRAIYDQLSADPHSLSN
LDQDLPNYAQHQIPIFSLPQVRDGAVSGRRS

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1248	1460	7.2e-99	0.8629032258064516

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	2.28e-150	1248	1460	1	215	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	4.56e-133	1248	1460	1	215	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	1.76e-45	1248	1460	1	209	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.44e-33	35	242	1	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	2.94e-22	1100	1206	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55512.1|GT24	0.0	13	1460	14	1452
AIG56125.1|GT24	0.0	8	1460	11	1442
UIZ20865.1|GT24	0.0	9	1460	10	1597
CCA14500.1|GT24	8.04e-285	21	1460	34	1602
BDA49281.1|GT24	4.23e-165	17	1460	27	1538

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	9.56e-126	16	1460	2	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	4.56e-125	16	1460	2	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	2.17e-124	16	1460	2	1394	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	4.94e-123	25	1455	4	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	8.36e-109	885	1460	547	1160	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	5.13e-162	23	1460	31	1515	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q9NYU2|UGGG1_HUMAN	1.56e-157	16	1460	38	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q6P5E4|UGGG1_MOUSE	1.85e-155	20	1460	42	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	2.23e-152	20	1460	42	1470	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	1.25e-148	29	1459	34	1453	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000517	0.999460	CS pos: 22-23. Pr: 0.8991

TMHMM  Annotations     

There is no transmembrane helices in H310_06945-t26_2-p1.