CAZyme Information: H310_06805-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_06805-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42340.39	5.9123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913963:835198-836408(+)

Full Sequence      

MQSVDGNGHRVHEGQSCKFAAHHPLSYAVYHLHPSEHVHIDGKLEEDAWTAAQWTAPFTD
IIGPKHWSQPWFETRVKMRYDDTFLYVGAYIQDTDVWATLTKRNSVVFTDNDFEIFVDPV
GTTHNYKEFEVNALNTTWNLFLNKPYRDGGAENSTRVDPVHGFDMLPWGLRSAVYTKGRV
NDPNQHVHYWTVEVALPLAALAWNTTAVVPPMLGSSWRINFSRVEWTVEVKNGRYEKTKN
LPEDNWVWSPQGDVAMHKPEMWGYLDFVQQNDSPVALKEDLEFPARYQAFAIYYAQKAFL
AQYNRYADTLDDLLPWIADKDVLSCLHVVYMSATADRFHAGTLAFGYTAHIRYDSFIYVT
TASSGAAALA

Enzyme Prediction     

No EC number prediction in H310_06805-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	40	265	9.3e-35	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
187678	CBM9_like_3	1.68e-59	40	264	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
187676	CBM9_like_2	4.95e-18	40	224	13	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
399451	CBM9_1	1.01e-04	40	203	1	134	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
187677	CBM9_like_4	0.002	40	201	4	141	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
187675	DOMON_like	0.004	74	223	20	148	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM88676.1|CBM9	3.66e-80	40	323	19	288
QOT09656.1|CBM0	1.17e-76	40	314	29	299
QLG42346.1|CBM0	6.40e-76	40	329	29	309
UOK64684.1|CBM0	3.60e-75	25	314	11	298
UPK45153.1|CBM9	3.60e-75	25	323	11	304

PDB Hits     

H310_06805-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

H310_06805-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000002

TMHMM  Annotations     

There is no transmembrane helices in H310_06805-t26_1-p1.