CAZyme Information: H310_06779-t26_2-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_06779-t26_2-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705		79458.58	6.8863

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913963:774959-777126(-)

Full Sequence      

MRQDSNNSRDSDDDFNQQNNALLGVPVWQDSSADVQNGSYLEAGTPHRAAPDNSRQPLHH
QYSQSSNTTRHHYAQQQLQQQPYQAPHMVNHMADPQMVIEGVQRQRQSNAIAVNAVPATT
EEAFRLIAVGVTAESEERYESAVRSFLDGGEMLCIVHERETDMHVRSLLNQKATQVIAWA
ETLNRWIESGRVGAAPKRDSFKVGVDMVNRLGKCAGPISAHSPSELRTMYYTPCANKVVS
DFTNEGYRLHCIEEGRSPQLMVVITMYNEDEVEMYSTLKKVANNIEHIKSKRLPGYEGDD
AWKNILVCVVSDGRTKANKGTLAFLRDVGVFDEDAMNIMMVGVDVQCHLFEFCVQLKKGK
DIAESVTSQHLYPPTQVVFALKEHNAGKLNSHEWYFNAFAEQIQPEYTVLLDVGTMPTAR
AFYLLLAAMELDPQIGGTCGEIAVDRPIPHLCNWVIAAQHFEYKISNIMDKSLESVFGFI
SVLPGAFSAYRYKAIRGAPLQAYFKSLTTPMHVLGAFQGNMYLAEDRILCFELLARKGQR
WTMQYVKDAIARTDVPTDLTALIGQRRRWLNGSFFALVYTILNWGRVYTESNHSYMRKFF
LCIQYAYMTANVALSWILPANFFLVTYYLVIIGFLDDNWGYIPTTKISPGAKQIAVQIFS
LLYGSSFLVQLVAGLGNKPKHIKYVLDRPTDALTRVAHTIETCTG

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	266	429	3.5e-52	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	4.44e-81	262	576	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	2.43e-63	266	429	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	3.03e-27	247	669	43	375	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	7.49e-23	406	582	203	383	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.00e-18	262	496	1	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE62520.1|GT2	3.81e-236	82	700	67	675
QKE45457.1|GT2	7.62e-200	119	685	36	601
ACA96933.2|GT2	2.61e-199	119	683	29	589
ARC77249.1|GT2	2.05e-181	119	683	93	653
ARC77250.1|GT2	8.12e-181	119	683	93	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	2.20e-13	119	187	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	1.99e-129	180	680	159	630	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P30599|CHS2_USTMA	2.41e-105	225	680	360	807	Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS2 PE=3 SV=2
sp|P30594|CHS1_RHIOL	2.95e-105	225	684	149	606	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	3.07e-104	225	683	151	614	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30588|CHS3_NEUCR	4.13e-104	240	679	195	632	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

Start	End
569	588
612	634
654	676