CAZyme Information: H310_06779-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_06779-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975		109213.41	8.7418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913963:774145-777237(-)

Full Sequence      

MSSRRNYAARGGGGPAGGSSGNNARAGRGHPPRGPPQMRQDSNNSRDSDDDFNQQNNALL
GVPVWQDSSADVQNGSYLEAGTPHRAAPDNSRQPLHHQYSQSSNTTRHHYAQQQLQQQPY
QAPHMVNHMADPQMVIEGVQRQRQSNAIAVNAVPATTEEAFRLIAVGVTAESEERYESAV
RSFLDGGEMLCIVHERETDMHVRSLLNQKATQVIAWAETLNRWIESGRVGAAPKRDSFKV
GVDMVNRLGKCAGPISAHSPSELRTMYYTPCANKVVSDFTNEGYRLHCIEEGRSPQLMVV
ITMYNEDEVEMYSTLKKVANNIEHIKSKRLPGYEGDDAWKNILVCVVSDGRTKANKGTLA
FLRDVGVFDEDAMNIMMVGVDVQCHLFEFCVQLKKGKDIAESVTSQHLYPPTQVVFALKE
HNAGKLNSHEWYFNAFAEQIQPEYTVLLDVGTMPTARAFYLLLAAMELDPQIGGTCGEIA
VDRPIPHLCNWVIAAQHFEYKISNIMDKSLESVFGFISVLPGAFSAYRYKAIRGAPLQAY
FKSLTTPMHVLGAFQGNMYLAEDRILCFELLARKGQRWTMQYVKDAIARTDVPTDLTALI
GQRRRWLNGSFFALVYTILNWGRVYTESNHSYMRKFFLCIQYAYMTANVALSWILPANFF
LVTYYLVIIGFLDDNWGYIPTTKISPGAKQIAVQIFSLLYGSSFLVQLVAGLGNKPKHIK
NLYRLTAVFYALVMTLTTVIAVGFILKPIIDKFKQGLKISDIQSILENFKIVDAAAFVAS
AGVFFLASALHCELHHIVLTFVQYMALLPTFVNILNTYSFCNLHDLSWGTKGLESSEGHG
PKASGGKGNFKDAVEKKKAEEARKAKEAKIKDEMEGSFQRFRSTLLIFWLMCNMGFAYSV
IVLDVNEAGQQGLNYLKFLFYTVAVFNLFRLVGSILFLISSFKLKVFRCCIRGTMEERIR
AKAKRRSQGPPGNIV

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	303	466	6e-52	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	4.25e-79	299	613	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	5.78e-62	303	466	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	3.27e-27	284	742	43	415	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.34e-22	443	619	203	383	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	2.57e-18	299	533	1	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE62520.1|GT2	3.62e-288	119	974	67	884
QKE45457.1|GT2	1.04e-245	156	968	36	829
ACA96933.2|GT2	2.48e-245	156	974	29	825
AEZ51041.1|GT2	9.41e-218	151	941	70	831
UIZ27519.1|GT2	4.52e-216	156	935	19	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	3.08e-13	156	224	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	3.95e-149	217	886	159	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P30595|CHS2_RHIOL	8.87e-128	262	939	151	852	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30588|CHS3_NEUCR	1.34e-127	277	939	195	881	Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=chs-3 PE=3 SV=2
sp|P30594|CHS1_RHIOL	5.36e-124	262	938	149	851	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30572|CHS2_CANAX	6.33e-124	277	940	290	995	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000022	0.000018

TMHMM  Annotations     

Start	End
606	625
649	671
691	713
726	745
794	816
881	903
918	940