CAZyme Information: H310_05634-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_05634-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	KI913960|CGC3	35818.86	9.4603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913960:1496718-1497698(+)

Full Sequence      

MIRQVASRAAARMGPSIRQAAPAVLTRSFHAASLPRAKASNAAAMSMAFLLASATSATLL
YAKEKPVNLAAVRDDIVALIESDNSLAPTLIRLAWHSSGTYSKVDGSGGSKGGTIRHDPE
INHGGNHGLVIVIEKLNAIKAKYPTLSHADLYIYAGVVAISEMGGPEVPFRLGRKDAPSQ
TACTPDDRLPAADKGSKPNTIKHIRDVFYRMGFNDREIVALIGAHAVGRCYPTRSGYSGP
WTRAETTFSNEYFRELVENKWTLKKWDGPEQYTDPTGDLMMLPADMAFLWDPQFKKYVDL
YAKDEDVWHKDFAKAFQKLTENGVKF

Enzyme Prediction     

No EC number prediction in H310_05634-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	79	323	1e-57	0.9372549019607843

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173825	ascorbate_peroxidase	3.61e-136	62	326	6	252	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
178218	PLN02608	7.32e-80	73	325	18	245	L-ascorbate peroxidase
173823	plant_peroxidase_like	1.36e-63	71	321	2	255	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
178467	PLN02879	4.76e-63	82	323	29	246	L-ascorbate peroxidase
166005	PLN02364	3.56e-58	73	323	20	246	L-ascorbate peroxidase 1

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22874.1|AA2	8.21e-131	1	326	1	329
QKY15243.1|AA2	2.32e-94	63	326	101	364
QRD85779.1|AA2	1.47e-90	83	326	110	348
QMW29426.1|AA2	1.47e-90	83	326	110	348
QMW41498.1|AA2	1.47e-90	83	326	110	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AL9_A	8.80e-76	63	325	2	260	Structure of Leishmania major peroxidase D211R mutant (high res) [Leishmania major],5ALA_A Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major],5ALA_B Structure of Leishmania major peroxidase D211R mutant (low res) [Leishmania major]
4GED_A	1.17e-75	63	325	2	260	Crystal Structure of the Leishmania Major Peroxidase-Cytochrome C Complex [Leishmania major]
5AMM_A	1.24e-75	63	325	2	260	Structure of Leishmania major peroxidase D211N mutant [Leishmania major],5AMM_B Structure of Leishmania major peroxidase D211N mutant [Leishmania major]
3RIV_A	1.28e-75	63	325	3	261	The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin],3RIV_B The Crystal Structure of Leishmania major Peroxidase [Leishmania major strain Friedlin]
3RIW_A	4.13e-74	63	325	3	261	The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin],3RIW_B The Crystal Structure of Leishmania major Peroxidase mutant C197T [Leishmania major strain Friedlin]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WPF8|CCPR_ASPFU	3.67e-92	83	326	114	352	Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=ccp1 PE=3 SV=1
sp|A4QVH4|CCPR_MAGO7	1.73e-86	72	326	92	346	Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CCP1 PE=3 SV=1
sp|Q4ING3|CCPR_GIBZE	6.14e-86	53	326	68	341	Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=CCP1 PE=3 SV=1
sp|Q7SDV9|CCPR_NEUCR	1.74e-85	71	326	89	344	Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ccp-1 PE=3 SV=1
sp|Q4PBY6|CCPR_USTMA	2.30e-84	83	324	132	368	Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CCP1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000037

TMHMM  Annotations     

There is no transmembrane helices in H310_05634-t26_1-p1.