CAZyme Information: H310_05438-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_05438-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		36077.83	7.1762

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913960:921228-922247(-)

Full Sequence      

MVAPAFSMTAAVVSAALFMPSVQGHGWLINPKVTFLDPYGDPSKFCGVVNGNKLYPSDNF
NLSPLDNTKAFLARFKVDYTSLKQFFDKNDNCGECGITKFGDAQKLPANGVVQWRNGGEG
FVSSHEGPCELWCDNTLVFQNDNCARNLPSGDMQIDVAKCAGSKKFIALWIALHSVDWQV
YKNCVALQDGVGPSPPSPTATAVTPTPPSSNTTTPVPLPLPTKKPMTPAPAPTTATPTPS
TPAPLKPTTPTPATSPSQYAGGWQQCGGNGFTGANECVHGYHCQVVTEWFHQCIPNVAGP
GDLKTYEQCGGRGWNGVGKCKDGDTCKALSPWFSQCVPS

Enzyme Prediction     

No EC number prediction in H310_05438-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	14	247	8.9e-69	0.9183673469387755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	1.77e-07	306	337	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
197593	fCBD	3.91e-07	263	294	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	4.26e-06	263	289	2	28	Fungal cellulose binding domain.
395595	CBM_1	1.44e-04	306	332	2	28	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ETW03002.1|AA17|CBM1	2.00e-195	1	307	1	307
ETV73941.1|AA17|CBM1	3.47e-140	1	307	1	336
ETV73948.1|AA17|CBM1	1.16e-70	15	295	14	271
ETV73947.1|AA17	6.57e-70	15	295	14	271
AIG55788.1|AA17|CBM1	1.63e-65	24	301	21	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	3.59e-12	69	187	38	170	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SDR1|GUN3_NEUCR	4.52e-08	260	300	18	58	Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gh5-1 PE=1 SV=1
sp|B8NIV9|MANF_ASPFN	2.91e-07	257	295	17	55	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manF PE=3 SV=1
sp|Q2U2I3|MANF_ASPOR	2.91e-07	257	295	17	55	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manF PE=3 SV=2
sp|A0A1D8EJG8|GCE1_SODAL	3.04e-07	254	300	15	60	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1
sp|P46239|GUNF_FUSOX	7.95e-07	263	299	22	58	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000559	0.999407	CS pos: 24-25. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in H310_05438-t26_1-p1.