CAZyme Information: H310_05405-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_05405-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		46616.46	6.7258

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913960:812713-814023(+)

Full Sequence      

MRLYSALATAVAMASAAPFNGVRPAMAYPVHANANAASDQLSTVSTTVRKRRLPPHTLVG
YWHNFANPSGPTFPLREISSDWDVIVVAFGSSVGGGTVKFDLDPAAGTEAQFISDISTLQ
GRNKTVVLSLGGQDGTVSLNDAAETARFVDSVAELLAKYGFDGIDLDVETGISQGLPIVN
NLISAVKQIKQRVGDSFYLSMAPEHPYVQGGAVSYGSIWGAYLPIIDGLRDELTQIHVQY
YNNGGFVYTDGRMLQEGTVDCLVGGSLMLINGFETNYGKGWRFRGLRPDQVSFGVPSGPQ
AAGRGFASADTLQNAVTCIAQGVGCDTIRPTSPHPTFRGIMTWSINWDRFDQFEFSRNAR
AALDGLPQVVQVGSSSAVKETTATTAQVRSVPAATLPTAPKNCGRCDNCYYSPTNACFSG
WTKAQCRSVSVFTWCG

Enzyme Prediction     

EC	3.2.1.14:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	57	246	2.6e-20	0.527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119350	GH18_chitinase_D-like	1.64e-125	56	361	1	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
226000	Chi1	7.21e-60	58	348	28	307	Chitinase [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	7.11e-21	57	348	1	307	Glycosyl hydrolases family 18.
119349	GH18_chitinase-like	5.54e-20	58	242	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119356	GH18_hevamine_XipI_class_III	2.42e-17	58	349	3	269	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55573.1|GH18	5.64e-171	41	420	28	400
AMC37111.1|CBM12|GH18	8.30e-147	53	367	106	423
AXE32296.1|CBM12|GH18	1.98e-138	56	372	109	426
AXE33636.1|CBM12|GH18	1.98e-138	56	372	109	426
AVG17835.1|CBM12|GH18	2.12e-137	56	381	106	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TX8_A	2.72e-137	56	381	107	435	Crystal Structure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]
3N11_A	3.51e-89	58	366	9	329	Crystal stricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	9.91e-89	58	366	9	329	Crystal stricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
3N17_A	3.95e-88	58	366	9	329	Crystal stricture of E145Q/Y227F chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
5KZ6_A	4.34e-88	58	367	12	333	1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27050|CHID_NIACI	1.31e-77	33	366	165	514	Chitinase D OS=Niallia circulans OX=1397 GN=chiD PE=1 SV=4
sp|Q05638|CHIX_STROI	2.17e-60	53	357	261	590	Exochitinase 1 OS=Streptomyces olivaceoviridis OX=1921 GN=chi01 PE=1 SV=1
sp|D4AVJ0|CHI2_ARTBC	2.33e-58	75	367	17	332	Probable class II chitinase ARB_00204 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00204 PE=1 SV=2
sp|A5FB63|CHIA_FLAJ1	1.52e-40	40	348	1127	1462	Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
sp|E9F7R6|CHI4_METRA	2.03e-33	46	363	31	345	Endochitinase 4 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chi4 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000465	0.999513	CS pos: 27-28. Pr: 0.8465

TMHMM  Annotations     

There is no transmembrane helices in H310_05405-t26_1-p1.