CAZyme Information: H310_04727-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_04727-t26_1-p1
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		68366.29	7.3395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913958:1886035-1887960(+)

Full Sequence      

MPPFKAAVEADVWSGMGTFVALNNVPLAANELMHKGLLRGDLGFKGLMVTDFKEIKMLVT
QHSYAPTVLEAVYASLSKATYDMSMVPDDGSFIETGKQLVAQNRIPESRLRESVLRIVKL
KLKLNLFDEPVPGADVLSQLGDEASQLSALAIARESMVLLKNQDNALPLTPGKASIFLTG
SSSDSIGLLCGGWTLWWQGTSLSQVFPLGASVRKAMETTLGGADKFSFYQGFDTDGNLVD
NDGKPGDLEAAKAMAAKADYTVVVLGERPYAEYKGNDDKQPLPPGFLTYVKALKSTGTKI
ILVLVEGRPRLLNGIADLAHAVIFAGLPCEYGGQAIVDVLLGKVNPSGRMAMTYPKTDTS
INLATPYYKRTNTSCLKDGIKYECPAEWQFGDGLSYTSFHYSNATISTTALSFSSTGSNA
FTVSVTVQNTGLVKGQETVLLFGTPPATRIHAETKLLKRFTKLSLAAGEAKGVTFSLSHQ
DLGYYSNDIGKGLKKDAPSGAYTFFLKHDTDCSTSTPLCMTLKWDNPDKASFMPNATVAP
TVVAPVGPSGPIKNGSTTVAPGSAPSDNDSASAGDDNQTVPVPMIVGISCGVVCACGILA
FLVSRRKAQQQKPLRTLHVMESKEDRVVIVDGGGSLTYKSL

Enzyme Prediction     

EC	3.2.1.21:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.00e-57	1	510	237	754	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.75e-31	157	396	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	8.85e-29	2	506	248	768	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.80e-13	1	120	201	316	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	8.55e-10	437	506	1	67	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56285.1|CBM13|GH3	1.76e-150	2	545	233	758
AIG55751.1|CBM13|GH3	9.86e-148	2	533	236	761
AIG55915.1|CBM13|GH3	1.18e-146	2	527	234	750
AIG56284.1|GH3	7.97e-139	2	530	232	746
UIZ29009.1|GH3	5.91e-133	1	533	250	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	1.29e-70	3	488	244	725	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	1.53e-41	1	489	217	724	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	6.81e-41	1	489	217	724	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	4.71e-40	1	510	205	722	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5M6G_A	1.12e-39	1	357	260	590	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	4.11e-72	1	488	312	797	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	8.26e-70	3	488	266	747	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	6.72e-43	1	523	210	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	5.48e-42	1	510	237	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	6.53e-40	1	510	237	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

Start	End
580	602