CAZyme Information: H310_04620-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_04620-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1031		116808.86	7.7829

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913958:1517779-1521602(-)

Full Sequence      

MDSVWTSHPQPNVVDRLPMAAHQKLVHGDSNPSNAEYMNSDTPNMALPVEDDTDENTIRV
FGWMHKQGTRVIRGPGAKSWRRRFFCLEGQKIYYFHEPVDARKYFNSRNPELCIGSIDLR
TAFKLEQSDRLDLPSKGLVIHTKIRKWLVCPETDAEFNMWFDALEETIMTNDAGNVVKRH
LPNVREYVMKGRTSYRVFYFLFLITALIELAGIVLWFPLGIEPCDLKLRTANCTEIFRKF
VPEEKPSCGEQPFNGMWNPPQFYKRQAGMLGVQCFREPTLAHWVSYFCFYFAEFISILLG
ALYYLGMWKPVRRGAHYLRDFNPPFPQDKWPTVDIMLCHYAEPAEDTMATLEAIMKLDYP
CEKLHVYICDDGGFKTKFTPGNPIPEVIVNKGVIENAGDVRYELAHFMYERVLDLDGEGQ
GIGYTRAVEMEVNEWRQSHTTVKMPTPSNPRVADRLDCAIGSERDDYDYRYAGLPRVTYV
GRFKPPTHHSKAGNINNVLYNEGASGRYAIILDNDMKPHPMFIQATLPFFFDSPASTKTF
RCSAPGCSDIAKITCTLCVQAGVPEATISYCSNDCFVASNHVHSQVHRRQTRTSKVNRTT
CTTCGGKVNMKSGTCSGCKKAMGRRTSVGTQEAAQYALALRDHYNDDVSNNQVGYVQTPQ
YFEDCLQLRLGDPCGHRNSTFFDSAQTGMDGYECASFAGTNAIFRRSALDSVCGIAYGSL
TEDAFTGKLMIDKGWKGLYFRKDFEGEESERIRLAEGAVPETVAASLAQRKRWAKGNFQI
FLRRKKSLIDPTWKPPTNIELPPPRKVNGFMRWVFFMNLTIYPIGSFPALFFFYITGYFL
FSGNAPIYTAGLRLLVALVPKIVVQSVLTAMMNRTVDNNDVLRSQQTWFSYAYVHVLAVI
DAIYWKITDKEAAWANTGALGGNSTMELPNILVFFAMVFGVIWSIVRFFVGYNSAETTHG
TPLLFGSMFLGLFTASQLGPMVRMSLQTYFGWSHKALTDQGNVVGSFSLAIVLSVLCLWV
YIENPHDNVWV

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	9.13e-34	331	781	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	3.65e-18	279	781	208	492	cellulose synthase catalytic subunit; Provisional
224136	BcsA	4.46e-15	649	943	164	433	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
215121	PLN02189	1.16e-13	308	1023	305	1022	cellulose synthase
133057	CESA_NdvC_like	2.45e-13	652	783	113	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEZ51040.1|GT2	0.0	58	1030	80	1031
ABP96909.1|GT2	0.0	49	1030	63	1021
AXF53810.1|GT2	0.0	42	1030	53	1018
ABP96905.1|GT2|2.4.1.12	0.0	42	1030	53	1018
ABP96913.1|GT2	0.0	58	1030	69	1018

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.72e-11	648	781	378	505	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
7D5K_A	3.45e-06	711	1023	730	1024	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.42e-23	461	896	568	880	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.60e-12	648	781	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|P19449|BCSA1_KOMXY	3.66e-12	648	781	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	3.67e-12	648	781	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P0CW87|ACSA1_KOMXY	9.77e-11	648	781	254	381	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
197	219
283	305
814	836
846	868
889	908
928	950
963	985
1000	1022