CAZyme Information: H310_04384-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_04384-t26_1-p1
• CAZy Family: GH38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	KI913958|CGC1	56312.64	7.7640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913958:466912-468601(+)

Full Sequence      

MRVAALFMAAIVALAAAQQTPTDIKTFRKCRHTSYVAEGNEIFAVDPLTPTTKTPIQIKG
VQWMGMETPDGIPAGMWGNGTIQRDSGISGTALADMLKFLYANKFNTVRLPLSARNFIDT
TYAPKVTNIHGENREIALYDKGFTPKMADFVARFIGSFQKYRISVVLDIHTLTEQFAQDA
FWYYPTKGAVEESIAYKTAVLLATYYCKPEYWNVMGIDLKNAMTEVDWPSKASTTLDWPS
AADAIAAKVNELCPQWLVFVAGSSKGSFTVKTNSYKVWPGMNFVNATVRPLKAKNIVYTP
QAFTQGVEPLGFFFDPKSNCSTAILADKDTECVVIENGLKVPNTKRALSCENSKLQCQSF
TPLSTSDMSALYQRLLDETVGPVVKEAKVPVVFGSFGGVYGSSQPLQSSVLDLIIKYLAT
STAGGFYASLNPDTEMWLEAPPPGNKTIGKARYGLMTSKSWQVPNADLLVALSGLKSSDI
PCYGDEVPGPPDTKTGTASTSWVSFIAAAVATACVLLA

Enzyme Prediction     

No EC number prediction in H310_04384-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	321	4.6e-51	0.7412790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.83e-09	42	300	31	272	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75347.1|GH5_20	5.31e-41	19	483	127	566
CCA26601.1|GH5_20	8.59e-40	20	483	137	564
ABL75348.1|GH5_20	8.68e-38	22	483	131	567
CCA27479.1|GH5_20	1.16e-36	30	501	153	584
CCA15003.1|GH5_20	2.29e-36	30	487	108	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHN_A	1.29e-13	19	313	34	309	Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_B Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_C Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHO_A	2.28e-13	19	313	34	309	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3VVG_A	3.70e-13	19	313	1	276	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	5.35e-13	19	313	34	309	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	5.35e-13	19	313	34	309	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

H310_04384-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999746	CS pos: 17-18. Pr: 0.9795

TMHMM  Annotations     

There is no transmembrane helices in H310_04384-t26_1-p1.