CAZyme Information: H310_04185-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_04185-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	KI913957|CGC6	48501.92	5.0579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913957:1784818-1792675(+)

Full Sequence      

MQYAWSNYETHAFGADEIAPVSGERRENVWGGIGVTLVDSLDTLYLMDMHDEFQRARDWV
ALSMDFSHLGQDGNTLSVFEIVIRQLGGLLSAYDLSQDDVFKHRAVELADLLLPAFSNGV
FYTHFNMHTKDTYLPHHGGKLRGLLADFGTLQLEMRYLSDITGNGVYRQMGEAFYTAVQR
EGSYKNTGLYPVEFEPEAGHFATDATMITVGARGDSFYEYLLKVWLYSGKRHEDAYLRKL
YDDAVDGMEKHLLVYSEMDDVYYLQELRLPDMDANPQQDHLLCFVPGMLALGTVDEQNTT
KAARHLDLAKKLMHTCTQFYLRQPSGLAPDLVEFPGWHIPNSMYKLRPETVESLMYMFRI
TQDPIYREWGWTIFESLEQHAKTKYGYGAVRNPSAPISTQLRTFGAFWPVLCTEMVTNTT
PLKT

Enzyme Prediction     

EC	3.2.1.113:73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	1	395	1.9e-110	0.8901345291479821

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	7.40e-150	1	392	2	403	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.12e-130	1	392	80	468	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55877.1|GH47	7.00e-177	1	392	85	485
UIZ22976.1|GH47	8.31e-157	1	392	145	551
CCD28123.1|GH47	4.62e-99	120	392	3	276
BDA46113.1|GH47	3.68e-87	1	408	167	570
BAS90892.1|GH47	1.53e-84	1	392	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	1.70e-74	1	392	30	417	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.15e-74	1	392	28	415	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	5.08e-72	3	396	15	403	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	5.49e-72	3	396	15	403	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	5.93e-72	3	396	20	408	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	1.36e-78	1	392	106	489	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|O18498|MA1A1_SPOFR	2.57e-75	1	392	205	594	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	1.38e-74	1	392	105	488	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.13e-73	1	396	188	580	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|P53624|MA1A1_DROME	3.71e-73	1	392	208	597	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in H310_04185-t26_1-p1.