CAZyme Information: H310_04116-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_04116-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
617	KI913957|CGC4	69345.05	7.1050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913957:1544329-1546182(+)

Full Sequence      

MVGVPPFVDSRVGRGNWDGAATSRFPARSPTSSSWIMAGVTKLQTCLALVALSMSSWHHQ
AEAKGVCYDSFDYANMDAHFTTIKTRFDAVRTYQTQNTLIGLLWPNGTNTTVHVPDGPNA
IDVAARNNLLIYAGVWIRSPFYDVDLQAAIDGATRHPEAVKAILIGNEDLSNGLSLRTMI
DTINDAKAKIRAVPGLEHIPIGTVQTDGDWLKYPSLANVCDVVGVNMYAFFDPYDFSTIN
NVIPHLSHRWQAMASRFGKKALLTETGWPTDGGGPFRNHQASMEAAIRHFWDVQDWMDVN
KNGGEHPMYFMFHDNPAKSTDVATLFENYFGLAYPSGVWKFDVWNRPVPSPRLSLPFKIA
TSRDLVLRCDGGRLFKGPSDNVNDRWSYDLRTQQLRCWQQGKCLDGYWTGNRFNVHLFPC
NANNNNQRWIFSDLKLKHEIFTDRCLDADRTDTQVQAWPCQLNNIHQLYTIASDMGHVAF
VSVDNKRALVASTAARDGDGAELIAFSHGWFPSQPAVPTDGKWTVLHDKNMIMSEITNTC
LDAPQKANGARIHLWPCNDSNANQKWSYDVATKQIRHVTHTGYCLDMGSYNGNKPHLWQC
HATTDAYAHYQQFNYVV

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	4.96e-18	492	613	15	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	3.21e-14	399	566	9	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.81e-14	499	614	20	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	6.99e-13	530	615	2	82	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	3.33e-12	400	566	6	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56197.1|CBM13|GH17	1.51e-129	61	617	26	551
AIG55595.1|CBM13|GH17	6.96e-127	62	617	16	560
AIG55519.1|CBM13|GH17	1.12e-126	63	617	17	553
AIG56230.1|CBM13|GH17	2.22e-95	47	617	1	508
AIG55518.1|CBM13|GH17	2.16e-90	64	605	20	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	9.46e-06	120	293	83	250	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

H310_04116-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.910228	0.089754

TMHMM  Annotations     

There is no transmembrane helices in H310_04116-t26_1-p1.