CAZyme Information: H310_03878-t26_1-p1

Basic Information

• Species: Aphanomyces invadans
• Lineage: Oomycota; NA; ; Saprolegniaceae; Aphanomyces; Aphanomyces invadans
• CAZyme ID: H310_03878-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		42327.24	5.1826

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AinvadansNJM9701	15416	N/A	168	15248

• Gene Location: location=KI913957:442766-444000(-)

Full Sequence      

MTQLTSQLHAPCHFVDCTMTKSSCTIVALVLASFCALPSLTLNVKLSGLNYNPRKGADWE
PWELKCKSAEEVTLDLRAISLITDHIRLYSMNDCNQVELVVPAAKALGLKVWLGMWVDQH
NTTYFAERDALKALIQKGVIDSSITGLHVGSEAIYRNDITVWEAIDYFWEVKAIVNNAGL
TFPVTIADVGDVYAGHPELFHVVDVVSANSFPFWENKTIDECITYFYMRMGPVIGMARVF
NKKIIIGETGWATSGWAYRAGVASPDNAALWLNDFHVFAQEFGWQYYYYFAFDTTWRHNT
DANITEPEVENYFGLFDSTRHLKPAYANLNIQKRKQYGYPPVPTWPNVPTPTESTWDVVQ
NVIAAVFTVFEGLW

Enzyme Prediction     

No EC number prediction in H310_03878-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	66	323	6.1e-19	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.23e-49	66	320	59	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56392.1|GH17	1.20e-96	27	349	4	327
AIG55390.1|GH17	6.64e-96	21	365	2	338
AIG56195.1|GH17	1.06e-90	28	331	4	312
AAY53769.1|GH17	4.03e-90	25	334	3	311
UIZ28880.1|GH17	2.89e-81	43	323	13	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	3.25e-35	48	325	39	291	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.38e-34	48	325	39	291	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y429|BTGC_ASPFC	1.05e-29	56	325	386	676	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	1.05e-29	56	325	386	676	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	1.43e-29	56	325	386	676	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|P15703|BGL2_YEAST	1.70e-29	66	323	40	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|A2QN74|BTGC_ASPNC	1.18e-28	56	325	382	672	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.982179	0.017849

TMHMM  Annotations     

There is no transmembrane helices in H310_03878-t26_1-p1.